SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_01_0202 + 1606317-1606487,1606743-1606805,1607045-1607116,160...    46   4e-05
03_06_0394 + 33592780-33593310,33593890-33594013,33594233-335943...    45   6e-05
07_03_1415 + 26410999-26411148,26411228-26411290,26412623-264126...    45   8e-05
04_04_0779 - 28023735-28024058,28024520-28024618,28024704-280249...    45   8e-05
12_01_0206 + 1555278-1555448,1555710-1555772,1556236-1556307,155...    44   2e-04
03_01_0099 + 778521-778736,779521-779775,779831-779924,780064-78...    43   3e-04
07_03_0947 - 22805419-22805571,22805736-22805966,22806161-228063...    42   4e-04
05_06_0173 - 26140725-26140838,26141125-26141352,26141440-261415...    42   4e-04
01_01_0620 - 4621291-4621379,4621722-4621803,4622238-4622282,462...    42   4e-04
12_02_1155 + 26541137-26541142,26541244-26542623,26542730-265428...    42   6e-04
03_02_0818 - 11496429-11496767,11496847-11496903,11497040-114971...    42   6e-04
10_08_0364 + 17217631-17217833,17218134-17218308,17218391-172184...    41   0.001
03_02_0633 + 9978193-9978376,9978661-9978845,9979284-9979466,997...    41   0.001
03_06_0070 + 31461372-31461467,31461581-31461823,31462486-314625...    40   0.002
02_01_0581 - 4307182-4307358,4307387-4307461,4307559-4307621,430...    40   0.002
10_08_0643 + 19541991-19542188,19543261-19543515,19543598-195437...    40   0.002
02_05_0235 - 27068516-27069032,27069697-27069788,27070056-270702...    40   0.002
12_01_0639 + 5383967-5385951,5386973-5387066,5387410-5387841,538...    40   0.003
03_05_0738 + 27267514-27268279,27268373-27268395                       40   0.003
12_01_1076 + 11184047-11184270,11186178-11186352,11186554-111866...    39   0.004
12_01_0084 - 678324-679643                                             39   0.004
11_01_0083 - 629885-631189                                             39   0.004
11_01_0449 - 3473662-3475049,3476026-3476128,3476215-3476439,347...    39   0.005
05_05_0298 - 23926266-23926442,23926573-23926632,23926822-239270...    39   0.005
03_01_0187 - 1492732-1492935,1493708-1493765,1494871-1494947,149...    39   0.005
01_06_0703 - 31326790-31326894,31327015-31327126,31327324-313274...    39   0.005
11_01_0660 + 5382460-5382764,5383854-5384348,5384454-5384541,538...    38   0.007
01_06_1236 + 35613123-35613816,35615809-35615952,35616032-356161...    38   0.007
01_02_0047 + 10621234-10621422,10621512-10621574,10623049-106231...    38   0.007
03_05_0890 - 28547462-28547545,28548451-28548528,28548641-285488...    38   0.012
01_06_1186 + 35223272-35224723,35225536-35225610,35226245-352265...    38   0.012
12_01_0450 - 3552701-3552865,3552971-3553195,3553306-3553473,355...    37   0.017
07_01_0363 - 2675951-2676049,2676146-2676279,2676362-2676395,267...    37   0.022
08_02_1048 + 23936193-23936376,23936731-23936915,23937332-239373...    36   0.029
06_03_0701 - 23655762-23655857,23656067-23656141,23656245-236563...    36   0.029
06_01_0185 - 1437693-1437834,1437969-1438078,1438214-1438264,143...    36   0.029
02_05_1033 + 33642479-33642688,33643089-33643343,33643479-336436...    36   0.029
01_01_0647 - 4909311-4909412,4909538-4909610,4909930-4910047,491...    36   0.038
12_02_0372 + 18212948-18213821,18213887-18214030,18214128-182142...    36   0.050
08_02_1430 - 27048055-27048408,27049674-27049841,27049927-270500...    36   0.050
07_03_1737 + 29137654-29137842,29137999-29138061,29138196-291382...    36   0.050
07_03_0588 - 19715677-19715754,19715843-19715942,19716170-197162...    36   0.050
02_01_0457 - 3283759-3285240                                           36   0.050
05_05_0154 - 22774503-22774652,22774738-22774968,22775508-227756...    35   0.067
02_05_0563 + 29998291-29998753,29999256-29999468,29999550-299996...    35   0.067
01_06_1074 + 34318685-34319314,34319429-34319546,34319662-343198...    35   0.067
12_01_0778 + 7111562-7112152,7113034-7113157,7113252-7113395,711...    35   0.088
06_03_0084 - 16386962-16387033,16387124-16387175,16387252-163873...    35   0.088
04_04_0786 - 28052981-28053040,28053123-28053222,28053447-280535...    35   0.088
02_05_0393 + 28571232-28572254                                         35   0.088
02_01_0590 + 4376785-4377009,4378153-4378407,4378514-4378641,437...    35   0.088
01_01_1098 - 8691312-8692430,8692640-8693509,8694522-8696105,869...    35   0.088
10_08_0781 + 20509033-20509714,20510048-20510191,20510604-205107...    34   0.12 
10_08_0603 - 19120434-19120538,19121209-19121310,19121430-191214...    34   0.12 
07_03_1698 + 28803971-28804534,28804614-28804696,28804780-288049...    34   0.12 
05_06_0042 - 25131962-25132149,25132261-25132345,25132750-251327...    34   0.12 
03_02_0909 - 12310460-12310759,12310882-12310989,12311099-123112...    34   0.12 
01_05_0438 + 22142646-22143659,22144319-22144858                       34   0.12 
05_07_0280 - 28920864-28920971,28921076-28921175,28921267-289213...    34   0.15 
05_05_0315 - 24030695-24030787,24030896-24030995,24031120-240312...    34   0.15 
02_04_0221 - 21021886-21022144,21022227-21022345,21022681-210229...    34   0.15 
12_01_0217 + 1647319-1648327,1648462-1648577,1648650-1648817,164...    33   0.20 
11_01_0216 + 1693889-1694897,1695034-1695149,1695222-1695389,169...    33   0.20 
09_03_0166 + 12956794-12956832,12956936-12956977,12957084-129571...    33   0.20 
07_03_1293 - 25563431-25563545,25564078-25564196,25564300-255644...    33   0.20 
04_04_1028 + 30230224-30231274,30231500-30231609,30232144-302321...    33   0.20 
02_05_0011 + 24953472-24954506                                         33   0.20 
01_05_0743 + 24835349-24836009,24836925-24837068,24837154-248373...    33   0.20 
07_03_1686 + 28657337-28658668                                         33   0.27 
07_03_1308 + 25662851-25662855,25663946-25663977,25664400-256645...    33   0.27 
07_03_0536 - 19205515-19205686,19205807-19205931,19206428-192065...    33   0.27 
03_03_0059 + 14149796-14150350,14152303-14152433,14153479-141535...    33   0.27 
03_01_0202 + 1605703-1606402,1606681-1606824,1606911-1607063,160...    33   0.27 
12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409...    33   0.36 
04_04_1659 - 35127145-35127204,35127324-35127464,35127597-351276...    33   0.36 
03_06_0273 + 32787021-32787434,32788096-32788221,32788305-327883...    33   0.36 
12_02_0929 - 24493168-24493458,24493545-24493643,24493768-244938...    32   0.47 
04_04_1457 - 33741048-33741146,33741647-33741760,33741938-337420...    32   0.47 
03_05_0297 - 22870052-22870342,22870436-22870534,22870624-228707...    32   0.62 
03_02_0444 - 8543426-8543635,8543945-8544151,8544293-8544400,854...    32   0.62 
02_05_0882 + 32477306-32478189,32478735-32478819,32478930-324789...    32   0.62 
03_05_0885 - 28505628-28505767,28505892-28505970,28506048-285061...    31   0.82 
03_05_0835 - 28065505-28065656,28066547-28066604,28067535-280676...    31   1.1  
09_04_0136 + 14972687-14973901                                         31   1.4  
07_03_1452 - 26629219-26629428,26630113-26630280,26630363-266304...    31   1.4  
03_02_0608 - 9818020-9818192,9818723-9818906,9818991-9819323,981...    31   1.4  
01_06_0872 + 32609792-32610178,32611262-32611387,32611477-326115...    31   1.4  
09_06_0347 + 22445962-22446154,22446495-22446616,22446764-224468...    30   1.9  
03_06_0235 + 32539025-32539886,32540330-32540473,32540595-325407...    30   1.9  
02_05_1008 - 33461225-33462334                                         30   1.9  
09_06_0146 + 21186889-21187178,21187321-21187435,21188595-211886...    30   2.5  
08_02_0813 + 21459776-21461128                                         30   2.5  
05_07_0010 - 27024013-27024171,27024286-27024699,27025389-270254...    30   2.5  
02_01_0279 - 1860410-1860508,1861536-1861889,1862660-1862805,186...    30   2.5  
10_08_0939 + 21696941-21697049,21697171-21697255,21698385-216984...    29   3.3  
03_06_0065 - 31399791-31399874,31399956-31400165,31400407-314005...    29   3.3  
03_06_0003 + 30921197-30921388,30921514-30921632,30921742-309218...    29   3.3  
02_05_0340 + 28105222-28105960,28106844-28106987,28107083-281072...    29   3.3  
02_01_0176 + 1207792-1208081,1208212-1208329,1208495-1208668,120...    29   3.3  
01_06_1163 - 35018862-35019623,35019702-35019951,35020871-35020929     29   3.3  
07_01_0437 - 3322132-3322251,3322345-3322569,3322953-3323120,332...    29   4.4  
03_06_0068 + 31439486-31439692,31441378-31441452,31441540-314416...    29   4.4  
03_01_0150 + 1191410-1191697,1191818-1191941,1192063-1192121,119...    29   4.4  
04_04_1689 + 35379627-35379746,35379823-35380344,35380428-353805...    29   5.8  
04_03_0983 + 21423086-21423280,21423330-21423404,21423531-214236...    29   5.8  
03_05_0675 + 26630466-26632070                                         29   5.8  
01_06_1485 + 37703696-37703815,37703970-37704044,37704598-377046...    29   5.8  
01_06_0453 + 29501600-29502403                                         29   5.8  
06_01_0636 + 4627533-4628546                                           28   7.6  
05_01_0268 - 2053420-2053539,2053636-2053710,2053805-2053867,205...    28   7.6  
03_06_0239 - 32578231-32578353,32578431-32578655,32579081-325792...    28   7.6  
01_06_1662 - 38974803-38974895,38975118-38975256,38976044-389761...    28   7.6  

>11_01_0202 +
           1606317-1606487,1606743-1606805,1607045-1607116,
           1607244-1607351,1607497-1607538,1607965-1608018,
           1608130-1608255,1608338-1608427,1608735-1608857,
           1608963-1609070,1609412-1609573,1609655-1609711,
           1609792-1609884
          Length = 422

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN ++IY   G   N  IV++Y+   +LF+T+   G +         +Q
Sbjct: 61  EISTMKLIK-HPNVVRIYEVMGSKTNIYIVLEYVTGGELFDTIVNHGRMREDEARRYFQQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 120 LINAVDYCHSRGVYHRDLK 138


>03_06_0394 +
           33592780-33593310,33593890-33594013,33594233-33594376,
           33594463-33594615,33594973-33595088,33595253-33595420,
           33595514-33595744,33596229-33596378
          Length = 538

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 18/79 (22%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ + M  HPN + +   +   +N  +VM+  +  +LF+ +  +G  + +  + + R 
Sbjct: 112 EVEIMRHMPSHPNIVSLRAAYEDEDNVHLVMELCEGGELFDRIVARGHYTERAAAAVTRT 171

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E +   H+H  +H D+K
Sbjct: 172 IVEVVQMCHRHGVMHRDLK 190


>07_03_1415 +
           26410999-26411148,26411228-26411290,26412623-26412694,
           26412798-26412905,26413023-26413103,26413176-26413229,
           26413282-26413315,26413405-26413451,26413538-26413747,
           26413861-26413962,26414240-26414356,26414460-26414531,
           26414645-26414719,26414866-26414970
          Length = 429

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 21/79 (26%), Positives = 45/79 (56%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN ++++          +V++Y++  +LF+ + +KG+LS +    + +Q
Sbjct: 54  EIATLKLLK-HPNVVRLHEVSASKTKIYMVLEYVNGGELFDKIALKGKLSEKEGRKLFQQ 112

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +A++  H+    H D+K
Sbjct: 113 LMDAVSYCHEKGVYHRDLK 131


>04_04_0779 -
           28023735-28024058,28024520-28024618,28024704-28024940,
           28025227-28025334,28025427-28025486,28025813-28025888,
           28025984-28026144,28026374-28026436,28026543-28026630,
           28026872-28027612,28027695-28028239
          Length = 833

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++ Y +    +   I ++Y+    + + LQ  G+L  Q + +  +Q+   L  LH 
Sbjct: 468 HPNIVQYYGSETVDDKLYIYLEYVSGGSIHKLLQEYGQLGEQAIRSYTQQILSGLAYLHA 527

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 528 KNTVHRDIK 536


>12_01_0206 +
           1555278-1555448,1555710-1555772,1556236-1556307,
           1556430-1556537,1556644-1556724,1556861-1556914,
           1557020-1557145,1557228-1557317,1557603-1557725,
           1557831-1557938,1558287-1558400,1558530-1558586,
           1558667-1558741,1558915-1558989
          Length = 438

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/79 (29%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN ++IY   G      IV++Y+   +LF+T+   G +         +Q
Sbjct: 61  EISTMKLIK-HPNVVRIYEVMGSKTKIYIVLEYVTGGELFDTIVNHGRMREDEARRYFQQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 120 LINAVDYCHSRGVYHRDLK 138


>03_01_0099 +
           778521-778736,779521-779775,779831-779924,780064-780116,
           780301-780339,781091-781159,781275-781445,781533-781598,
           782533-782601,782993-783060,783308-783430,784095-784228,
           784412-784506,784600-784644,784755-784814,785548-785599,
           785674-785714,785857-785921,786704-786755,787021-787092
          Length = 612

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 6/90 (6%)
 Frame = -3

Query: 253 NFNVDEI-KVHQLMN--DHPNFIKIYFNHGFINNQVIVMDYID---CPDLFETLQIKGEL 92
           N N+D+I K  Q M+  DHPN I+ Y +    +N  ++M ++    C  L +     G  
Sbjct: 69  NSNLDDIRKEAQTMSLIDHPNVIRAYCSFVVDHNLWVIMPFMSEGSCLHLMKVAYPDG-F 127

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              ++++I+++  +AL  LH+   IH D+K
Sbjct: 128 EEPVIASILKETLKALEYLHRQGHIHRDVK 157


>07_03_0947 -
           22805419-22805571,22805736-22805966,22806161-22806328,
           22806425-22806540,22806853-22807005,22807241-22807384,
           22807584-22807707,22808126-22808689
          Length = 550

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 18/79 (22%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + +  HPN + +   +   N   +VM+  +  +LF+ +  +G  + +  + + R 
Sbjct: 123 EVDIMRHLPKHPNIVTLRDTYEDDNAVHLVMELCEGGELFDRIVARGHYTERAAALVTRT 182

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E +   HKH  +H D+K
Sbjct: 183 IVEVVQMCHKHGVMHRDLK 201


>05_06_0173 -
           26140725-26140838,26141125-26141352,26141440-26141580,
           26141707-26141790,26141866-26141955,26142048-26142233,
           26142327-26142458,26142559-26142741,26142967-26143151,
           26143915-26144089
          Length = 505

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 21/79 (26%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ +L   HP+ I++Y       +  +VM+Y+   +LF+ +  KG L  +      +Q
Sbjct: 62  EIKILRLFM-HPHIIRLYEVIDTPADIYVVMEYVKSGELFDYIVEKGRLQEEEARRFFQQ 120

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H++  +H D+K
Sbjct: 121 IISGVEYCHRNMVVHRDLK 139


>01_01_0620 -
           4621291-4621379,4621722-4621803,4622238-4622282,
           4623701-4623892,4625224-4625337,4625430-4625561,
           4626356-4626440,4626526-4626605,4626791-4627034,
           4627376-4627617,4628232-4628315,4628427-4628601,
           4629351-4629464,4630025-4630236
          Length = 629

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 18/65 (27%), Positives = 34/65 (52%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++        ++M+Y+   D+   L  +  L+  +    I +   A+  +HKHN+I
Sbjct: 215 VKLYYSFQDSEYLYLIMEYLPGGDIMTLLMREDTLTEHVARFYIAETILAIESIHKHNYI 274

Query: 16  HNDIK 2
           H DIK
Sbjct: 275 HRDIK 279


>12_02_1155 +
           26541137-26541142,26541244-26542623,26542730-26542852,
           26542996-26543168,26543332-26543572,26543931-26544023,
           26544092-26544232,26544358-26544450,26544633-26544837,
           26544993-26545078,26545532-26545620,26545736-26545820,
           26545898-26545954,26546319-26546399,26547130-26547321
          Length = 1014

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 20/69 (28%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           +P  ++ +++     N  +VM+Y++  DL+  L+  G L   +    + +L  AL  LH 
Sbjct: 669 NPFVVRFFYSFTCRENLYLVMEYLNGGDLYSLLRNLGCLDEDMARTYMAELVLALEYLHS 728

Query: 28  HNFIHNDIK 2
            N IH D+K
Sbjct: 729 MNVIHRDLK 737


>03_02_0818 -
           11496429-11496767,11496847-11496903,11497040-11497153,
           11497298-11497408,11497502-11497624,11497918-11498007,
           11498088-11498213,11498317-11498370,11498464-11498544,
           11498626-11498733,11498852-11498923,11499031-11499093,
           11500003-11500194
          Length = 509

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++   G      IV++Y+   +LFE +   G L  +      +QL  A++  H 
Sbjct: 77  HPNVVRLFEVMGSKARIFIVLEYVTGGELFEIIATNGRLKEEEARKYFQQLINAVDYCHS 136

Query: 28  HNFIHNDIK 2
               H D+K
Sbjct: 137 RGVYHRDLK 145


>10_08_0364 +
           17217631-17217833,17218134-17218308,17218391-17218474,
           17218561-17218802,17218883-17219108,17219246-17219325,
           17219408-17219492,17219665-17219796,17219927-17220040,
           17220123-17220170,17220413-17220497,17220722-17220834
          Length = 528

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/70 (27%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DH   +K+Y +        ++M+Y+   D+   L  K  L+       + +   A+  +H
Sbjct: 169 DHHCIVKLYCSFQDSEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYVGETVLAIEAIH 228

Query: 31  KHNFIHNDIK 2
           +HN+IH DIK
Sbjct: 229 RHNYIHRDIK 238


>03_02_0633 +
           9978193-9978376,9978661-9978845,9979284-9979466,
           9979564-9979695,9979826-9980011,9980381-9980470,
           9980540-9980623,9980704-9980844,9980919-9981146,
           9981511-9981624
          Length = 508

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 22/79 (27%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ +L   HP+ I++Y       +  +VM+Y    +LF+ +  KG L       I +Q
Sbjct: 65  EIKILRLFI-HPHIIRLYEVIYTPTDIYVVMEYCKFGELFDYIVEKGRLQEDEARRIFQQ 123

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H++  +H D+K
Sbjct: 124 IISGVEYCHRNMVVHRDLK 142


>03_06_0070 +
           31461372-31461467,31461581-31461823,31462486-31462581,
           31463430-31463644,31463726-31463798,31463889-31464005
          Length = 279

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/70 (28%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN ++++         V+V++Y    +L++ L+     S +  +  +  L  AL   H
Sbjct: 67  DHPNVLRLFAWFHDAERVVLVLEYAARGELYKLLRTVRRFSERTAATYVASLAGALAYCH 126

Query: 31  KHNFIHNDIK 2
           K   IH DIK
Sbjct: 127 KKQVIHRDIK 136


>02_01_0581 -
           4307182-4307358,4307387-4307461,4307559-4307621,
           4307715-4307819,4307917-4308024,4308123-4308260,
           4308357-4308446,4308533-4308658,4308728-4308781,
           4308865-4308936,4309060-4309167,4309272-4309343,
           4309456-4309518,4309747-4309908
          Length = 470

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 23/79 (29%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+N HPN +KIY          +VM+Y+    L + L     L  +       Q
Sbjct: 58  EITAMKLLN-HPNIVKIYEVIATKTKICLVMEYVSGGQLSDKLSYLKRLDEKEAKKYFYQ 116

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +A++  H+    H D+K
Sbjct: 117 LIDAVDYCHRRGVYHRDLK 135


>10_08_0643 +
           19541991-19542188,19543261-19543515,19543598-19543722,
           19543815-19543859,19544618-19544699,19545099-19545167,
           19545276-19545446,19545530-19545595,19546236-19546273,
           19547478-19547759,19548286-19548419,19548887-19548981,
           19549083-19549127,19549250-19549309,19549483-19549584,
           19549852-19549903,19549982-19550034,19550138-19550202,
           19550579-19550630,19550780-19550857
          Length = 688

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 6/90 (6%)
 Frame = -3

Query: 253 NFNVDEIKVH-QLMN--DHPNFIKIYFNHGFINNQVIVMDYI---DCPDLFETLQIKGEL 92
           N N+DEI+   Q+M+  +HPN I+ Y +    ++  +VM ++    C  L +     G  
Sbjct: 63  NNNIDEIQREAQIMSLIEHPNVIRAYCSFVVEHSLWVVMPFMTEGSCLHLMKIAYPDG-F 121

Query: 91  SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              ++ +I+++  +AL  LH+   IH D+K
Sbjct: 122 EEPVIGSILKETLKALEYLHRQGQIHRDVK 151


>02_05_0235 - 27068516-27069032,27069697-27069788,27070056-27070289,
            27071569-27071676,27071796-27071855,27072368-27072443,
            27072550-27072710,27076919-27076981,27077061-27077148,
            27077568-27078308,27078406-27079033,27079314-27079368,
            27082073-27083527
          Length = 1425

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
            HPN ++ Y +    +   I ++Y+    + + LQ  G+     + +  +Q+   L  LH 
Sbjct: 999  HPNIVRYYGSEMVDDKLYIYLEYVSGGSIHKLLQEYGQFGEPAIRSYTKQILLGLAYLHA 1058

Query: 28   HNFIHNDIK 2
             N +H DIK
Sbjct: 1059 KNTVHRDIK 1067


>12_01_0639 + 5383967-5385951,5386973-5387066,5387410-5387841,
            5387935-5388219,5388324-5388641,5388756-5388983,
            5389264-5389364,5389447-5389552,5389782-5390132,
            5390262-5390401,5390687-5390861,5390937-5390954
          Length = 1410

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 28/89 (31%), Positives = 47/89 (52%), Gaps = 6/89 (6%)
 Frame = -3

Query: 250  FNVDEIKVHQLMNDHPNFIKIYFNHGFINNQV-----IVMDYIDCPDLFETLQIKG-ELS 89
            F   EIK+ + + DHPN IK+    G + ++V     +V +Y++  DL   +   G +LS
Sbjct: 875  FMAREIKILRTL-DHPNVIKL---QGIVTSRVSQSLYLVFEYME-HDLSGLIATPGLKLS 929

Query: 88   HQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
               +   ++QL   L+  HK+  +H DIK
Sbjct: 930  EPQIKCFVQQLLHGLDHCHKNGVLHRDIK 958


>03_05_0738 + 27267514-27268279,27268373-27268395
          Length = 262

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 17/79 (21%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ +   + DHP  +++   +   +   +VM+  D  +LF+ +  +G  + +  +   R 
Sbjct: 149 EVAIMASLPDHPALVRLRAAYEDADAVHLVMELCDGGELFDRIVARGRYTERAAAAAART 208

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E +   H H  +H D+K
Sbjct: 209 VAEVVRACHAHGVMHRDLK 227


>12_01_1076 +
           11184047-11184270,11186178-11186352,11186554-11186637,
           11186712-11186953,11187029-11187266,11187814-11187893,
           11187968-11188052,11188148-11188279,11188358-11188471,
           11189550-11189594,11189840-11189924,11190043-11190102,
           11190178-11190317
          Length = 567

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 20/70 (28%), Positives = 33/70 (47%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D    +K+Y +        +VM+Y+   D+   L  K  L+       + +   A+  +H
Sbjct: 176 DSAYIVKLYCSFQDEEFLYLVMEYLPGGDMMTLLMRKDTLTDDESRFYVAETILAIESIH 235

Query: 31  KHNFIHNDIK 2
           KHN+IH DIK
Sbjct: 236 KHNYIHRDIK 245


>12_01_0084 - 678324-679643
          Length = 439

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 18/69 (26%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N ++++      N    VM+Y+   +LFE +  +G+L+  +     +QL  A++  H 
Sbjct: 69  HKNIVQLHEVMATRNKIYFVMEYVKGGELFEKVAKRGKLTEVVAHKYFQQLISAVDYCHS 128

Query: 28  HNFIHNDIK 2
               H D+K
Sbjct: 129 RGVYHRDLK 137


>11_01_0083 - 629885-631189
          Length = 434

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 18/69 (26%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H N ++++      N    VM+Y+   +LFE +  +G+L+  +     +QL  A++  H 
Sbjct: 69  HKNIVQLHEVMATRNKIYFVMEYVKGGELFEKVAKRGKLTEVVAHKYFQQLISAVDYCHS 128

Query: 28  HNFIHNDIK 2
               H D+K
Sbjct: 129 RGVYHRDLK 137


>11_01_0449 -
           3473662-3475049,3476026-3476128,3476215-3476439,
           3476689-3476856,3477414-3477529,3477640-3477792,
           3477879-3478022,3478980-3479583
          Length = 966

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKI---YFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           EI++   +++HPN ++I   Y +  F++   IVM+     +LF+ +  KG  + +  + +
Sbjct: 95  EIQIMHHLSEHPNVVRIRGAYEDALFVH---IVMELCAGGELFDRIVAKGHYTERAAAQL 151

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           IR +   +   H    +H D+K
Sbjct: 152 IRTIVAVVEGCHSLGVMHRDLK 173


>05_05_0298 -
           23926266-23926442,23926573-23926632,23926822-23927029,
           23927471-23927703,23928806-23928860,23928943-23929649
          Length = 479

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 18/69 (26%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I ++  +  ++   +V++     +LF+ +  +   S    + +IRQ+   L  LHK
Sbjct: 97  HPNVINLHDVYEDVHGVHLVLELCSGGELFDRIVGRDRYSEFDAACVIRQIASGLEALHK 156

Query: 28  HNFIHNDIK 2
            + +H D+K
Sbjct: 157 ASIVHRDLK 165


>03_01_0187 -
           1492732-1492935,1493708-1493765,1494871-1494947,
           1495086-1495160,1495259-1495315,1495451-1495567,
           1495805-1495915,1496029-1496151,1496304-1496393,
           1496480-1496605,1496687-1496740,1496975-1497055,
           1497147-1497254,1497443-1497514,1497626-1497688,
           1498417-1498629
          Length = 542

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN ++++      +   +V++Y+D  +LF+ +   G L          Q
Sbjct: 75  EISTMKLIK-HPNVVQLHEVMASKSKIYMVLEYVDGGELFDKIVNSGRLGEDEARRYFHQ 133

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 134 LINAVDYCHSRGVYHRDLK 152


>01_06_0703 -
           31326790-31326894,31327015-31327126,31327324-31327445,
           31327573-31327658,31327783-31327901,31327991-31328053,
           31328142-31328221,31328801-31328921,31329040-31329125,
           31329318-31329413,31329510-31329584,31329869-31330210
          Length = 468

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 31/115 (26%), Positives = 54/115 (46%), Gaps = 4/115 (3%)
 Frame = -3

Query: 334 QRAFWQNIYF-IAQAH*QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQ 158
           ++A W+ I   + +    ++  EN   A F  DE+ V QL+  HPN ++        +  
Sbjct: 175 RKATWRGILVAVKKLDDDLIMDENKVQA-FR-DELDVLQLIR-HPNVVQFLGAVTQSSPM 231

Query: 157 VIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHN---FIHNDIK 2
           +IVM+++   DL + L  KG L       +   +   +N LH+H     IH D++
Sbjct: 232 MIVMEFMPKGDLRKHLSRKGALEPSYAVKLALDIARGMNYLHEHKPQAIIHRDLE 286


>11_01_0660 +
           5382460-5382764,5383854-5384348,5384454-5384541,
           5384629-5384691,5384965-5385125,5385214-5385289,
           5385395-5385454,5385555-5385662,5385746-5385982,
           5386192-5386307,5386756-5386813
          Length = 588

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 18/69 (26%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++ Y +        + ++Y+    + + LQ  G     ++ N   Q+   L  LH 
Sbjct: 306 HPNIVQYYGSDLSSETLSVYLEYVSGGSIHKLLQEYGAFGEAVLRNYTAQILSGLAYLHG 365

Query: 28  HNFIHNDIK 2
            N +H DIK
Sbjct: 366 RNTVHRDIK 374


>01_06_1236 +
           35613123-35613816,35615809-35615952,35616032-35616184,
           35616572-35616687,35616800-35616967,35617647-35617707,
           35617772-35617824,35618278-35618508,35618600-35618749
          Length = 589

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 14/51 (27%), Positives = 29/51 (56%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+  +  +LF+ +  +G  + +  +N+ R + E +   H+H  IH D+K
Sbjct: 153 LVMELCEGGELFDRIVARGHYTERAAANVTRTIVEVVQLCHRHGVIHRDLK 203


>01_02_0047 +
           10621234-10621422,10621512-10621574,10623049-10623120,
           10623163-10623234,10623335-10623442,10623615-10623695,
           10623780-10623833,10623921-10624046,10624139-10624345,
           10624457-10624558,10624711-10624827,10624930-10625001,
           10625096-10625170,10625297-10625416
          Length = 485

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 15/51 (29%), Positives = 31/51 (60%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +V++Y++  +LF+ + +KG+LS      + +QL +A++  H     H D+K
Sbjct: 118 MVLEYVNGGELFDKIAVKGKLSEHEGRRLFQQLIDAVSYCHDKGVYHRDLK 168


>03_05_0890 - 28547462-28547545,28548451-28548528,28548641-28548814,
            28548902-28548958,28549065-28549116,28549907-28549995,
            28550259-28550344,28550427-28550637,28551790-28551882,
            28551958-28552098,28552175-28552267,28553879-28554113,
            28554263-28554435,28555234-28556571,28556668-28556853,
            28557625-28557713,28557756-28557905,28557951-28558596
          Length = 1324

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
            +P  ++ +++     N  +VM+Y++  DL+  L+  G L   +    + ++  AL  LH 
Sbjct: 967  NPFVVRFFYSFTSRENLYLVMEYLNGGDLYSLLRNLGCLDEDVARIYLAEVVLALEYLHS 1026

Query: 28   HNFIHNDIK 2
             + +H D+K
Sbjct: 1027 MHIVHRDLK 1035


>01_06_1186 +
           35223272-35224723,35225536-35225610,35226245-35226585,
           35226621-35227005,35227131-35227559
          Length = 893

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+  HPN ++++      +    V++Y    +LF  +  +G+LS         Q
Sbjct: 59  EISIMRLVK-HPNVLQLFEVMASKSKIYFVLEYAKGGELFNKIAKEGKLSEDSARRYFHQ 117

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 118 LINAVDYCHSRGVYHRDLK 136


>12_01_0450 -
           3552701-3552865,3552971-3553195,3553306-3553473,
           3554514-3554629,3554735-3554887,3554978-3555121,
           3556667-3557276
          Length = 526

 Score = 37.1 bits (82), Expect = 0.017
 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKI---YFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           EI++   +++HPN ++I   Y +  F++   IVM+     +LF+ +  KG  + +  + +
Sbjct: 97  EIQIMHHLSEHPNVVRIRGAYEDALFVH---IVMELCAGGELFDRIVAKGHYTERAAALL 153

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           IR +   +   H    +H D+K
Sbjct: 154 IRTIVGVVEGCHSLGVMHRDLK 175


>07_01_0363 -
           2675951-2676049,2676146-2676279,2676362-2676395,
           2676485-2676604,2676720-2676836,2676924-2677043,
           2677129-2677218,2677313-2677438,2677566-2677619,
           2677856-2677936,2678025-2678132,2678218-2678289,
           2678885-2678947,2679476-2679646
          Length = 462

 Score = 36.7 bits (81), Expect = 0.022
 Identities = 21/79 (26%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI   +L+  HPN I+++          IVM+ +   +LF+ +  +G L         +Q
Sbjct: 61  EISTMKLIR-HPNVIRMHEVMASKTKIYIVMELVTGGELFDKIASRGRLKEDDARKYFQQ 119

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 120 LINAVDYCHSRGVYHRDLK 138


>08_02_1048 +
           23936193-23936376,23936731-23936915,23937332-23937334,
           23937354-23937536,23937627-23937758,23937889-23938074,
           23938412-23938501,23938559-23938654,23938735-23938875,
           23938955-23939185,23939564-23939677
          Length = 514

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EIK+ +L   HP+ I++Y       +  +VM+Y    +LF+ +  KG L       I +Q
Sbjct: 65  EIKILRLFI-HPHIIRLYEVIYTPTDIYVVMEYCKFGELFDYIVEKGRLQEDEARRIFQQ 123

Query: 58  -LCEALNDLHKHNFIHNDIK 2
            +   +   H++  +H D+K
Sbjct: 124 KIISGVEYCHRNMVVHRDLK 143


>06_03_0701 -
           23655762-23655857,23656067-23656141,23656245-23656301,
           23656385-23656501,23657286-23657405,23657491-23657613,
           23657967-23658056,23658184-23658309,23658809-23658901,
           23658947-23659021,23659115-23659222,23659481-23659552,
           23659673-23659735,23660850-23661017
          Length = 460

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 19/79 (24%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +++  HPN +++           I+++ I   +LF+ +  +G+L         +Q
Sbjct: 60  EISIMKIVR-HPNIVRLNEVLAGKTKIYIILELITGGELFDKIARQGKLRENEARKYFQQ 118

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L +A+N  H     H D+K
Sbjct: 119 LIDAINYCHSKGVYHRDLK 137


>06_01_0185 -
           1437693-1437834,1437969-1438078,1438214-1438264,
           1438877-1439122,1439244-1439315,1439614-1439648,
           1439755-1439845,1440546-1440610,1440733-1440813,
           1441020-1441137,1441535-1441627,1441865-1441997,
           1442471-1442503,1443264-1443343,1443444-1443549,
           1443621-1443795,1443884-1443980,1444819-1445251,
           1445329-1445459,1446052-1446341,1446429-1447002
          Length = 1051

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI+V   ++ HPN + +   +    +  +VM+     +LF  L+ +G  S    + + R 
Sbjct: 85  EIEVMARLSGHPNVVDLKAVYEDEASVHLVMELCAGGELFHRLEERGCFSEHEAAALFRY 144

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L E +   H    +H D+K
Sbjct: 145 LMEVVAHCHSKGIVHRDLK 163


>02_05_1033 +
           33642479-33642688,33643089-33643343,33643479-33643603,
           33643827-33643908,33644008-33644076,33644102-33644341,
           33644431-33644496,33645087-33645155,33645229-33645366,
           33645681-33645754,33646146-33646255,33646428-33646525,
           33646595-33646633,33646771-33646890,33646984-33647109,
           33647321-33647382,33647467-33647518,33648182-33648436
          Length = 729

 Score = 36.3 bits (80), Expect = 0.029
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 5/78 (6%)
 Frame = -3

Query: 220 LMNDHPNFIKIYFNHGFINNQV--IVMDYI---DCPDLFETLQIKGELSHQLVSNIIRQL 56
           ++ D PN +K + +  F NN    +VM Y+    C  + +++   G     +++ ++R++
Sbjct: 81  ILIDQPNVMKAHCS--FTNNHSLWVVMPYMAGGSCLHIMKSVYPDG-FEEAVIATVLREV 137

Query: 55  CEALNDLHKHNFIHNDIK 2
            + L  LH H  IH D+K
Sbjct: 138 LKGLEYLHHHGHIHRDVK 155


>01_01_0647 -
           4909311-4909412,4909538-4909610,4909930-4910047,
           4910133-4910229,4910350-4910445,4910536-4910631,
           4910725-4910871,4911877-4911987,4912582-4912620
          Length = 292

 Score = 35.9 bits (79), Expect = 0.038
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQV---IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALND 38
           HPN +++Y   G+  +Q    ++++Y    +L++ LQ     S +  +  I  L  AL  
Sbjct: 86  HPNILRLY---GYFYDQTRVYLILEYALKGELYKELQRCKHFSERRSATYIASLAHALIY 142

Query: 37  LHKHNFIHNDIK 2
           LH  + IH DIK
Sbjct: 143 LHGKHVIHRDIK 154


>12_02_0372 +
           18212948-18213821,18213887-18214030,18214128-18214273,
           18214854-18214862
          Length = 390

 Score = 35.5 bits (78), Expect = 0.050
 Identities = 19/79 (24%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +  HPN I I  ++       IVM+     +LF+ +  KG  + +  + + R 
Sbjct: 185 EIRIMHHLAGHPNIISIRGSYEDAMAVHIVMELCTGGELFDRIISKGYYTERQAAEVARI 244

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    +H D+K
Sbjct: 245 IVSVIESCHSLGVMHRDLK 263


>08_02_1430 -
           27048055-27048408,27049674-27049841,27049927-27050042,
           27050153-27050305,27050850-27050993,27051052-27051211,
           27051332-27051970
          Length = 577

 Score = 35.5 bits (78), Expect = 0.050
 Identities = 14/51 (27%), Positives = 28/51 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+  +  +LF+ +  +G  S +  +NI R + + +   H +  IH D+K
Sbjct: 176 LVMELCEGGELFDRIVARGHYSERAAANIFRTIVDVVQLCHSNGVIHRDLK 226


>07_03_1737 +
           29137654-29137842,29137999-29138061,29138196-29138267,
           29138411-29138518,29138615-29138695,29138818-29138871,
           29138956-29139081,29139162-29139251,29139444-29139566,
           29139667-29139777,29139927-29140040,29140214-29140270,
           29140350-29140424,29140526-29140600
          Length = 445

 Score = 35.5 bits (78), Expect = 0.050
 Identities = 17/69 (24%), Positives = 30/69 (43%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN + ++   G      IV++Y+   +L + +   G L         +QL  A++  H 
Sbjct: 76  HPNVVHLHEVMGSKTRIFIVLEYVMGGELHDIIATSGRLKEDEARKYFQQLINAVDYCHS 135

Query: 28  HNFIHNDIK 2
               H D+K
Sbjct: 136 RGVYHRDLK 144


>07_03_0588 -
           19715677-19715754,19715843-19715942,19716170-19716297,
           19716385-19716552,19716623-19716735,19716820-19716972,
           19717082-19717225,19718710-19719427
          Length = 533

 Score = 35.5 bits (78), Expect = 0.050
 Identities = 19/79 (24%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++ Q ++   N ++    +   +N  +VM+     +LF+ +  KG  S +  + I R 
Sbjct: 133 EIQIMQHLSGQQNIVEFRGAYEDKSNVHVVMELCAGGELFDRIIAKGHYSERAAATICRA 192

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +N  H    +H D+K
Sbjct: 193 VVNVVNICHFMGVMHRDLK 211


>02_01_0457 - 3283759-3285240
          Length = 493

 Score = 35.5 bits (78), Expect = 0.050
 Identities = 19/79 (24%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + +L+  HPN ++++      +    V++Y    +LF+ +  KG+ S  +      Q
Sbjct: 60  EISIMRLVK-HPNILQLFEVMASKSKIYFVLEYAKGGELFKKIS-KGKFSEDVARRYFHQ 117

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   ++  H     H D+K
Sbjct: 118 LISGIDYCHSRGVYHRDLK 136


>05_05_0154 -
           22774503-22774652,22774738-22774968,22775508-22775675,
           22775760-22775936,22776281-22776302,22776351-22776417,
           22776583-22776774,22776819-22776962,22778421-22779102
          Length = 610

 Score = 35.1 bits (77), Expect = 0.067
 Identities = 13/51 (25%), Positives = 28/51 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+  +  +LF+ +  +G  + +  + + R + E +   H+H  IH D+K
Sbjct: 149 LVMELCEGGELFDRIVARGHYTERAAAAVTRTIVEVVQLCHRHGVIHRDLK 199


>02_05_0563 +
           29998291-29998753,29999256-29999468,29999550-29999667,
           30000227-30000355,30000438-30000810,30000890-30001147,
           30001192-30001227
          Length = 529

 Score = 35.1 bits (77), Expect = 0.067
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 7/77 (9%)
 Frame = -3

Query: 211 DHPNFIKIYF-------NHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLC 53
           DH N + +Y        + G + N + +        L E L  + EL  Q   N+  QL 
Sbjct: 274 DHVNIVDLYSAWIEKKKSFGSVTNVIYICMKECARSLSEYLNKRQELGLQNEHNMFAQLI 333

Query: 52  EALNDLHKHNFIHNDIK 2
           ++L  +H+H  +H D+K
Sbjct: 334 DSLIFMHRHGIVHRDVK 350


>01_06_1074 +
           34318685-34319314,34319429-34319546,34319662-34319814,
           34319906-34320021,34320135-34320302,34320424-34320551,
           34320645-34320744,34320866-34320958
          Length = 501

 Score = 35.1 bits (77), Expect = 0.067
 Identities = 16/79 (20%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++   +   PN +++   +    +  +VM+     +LF+ +  KG  + +  ++++R 
Sbjct: 109 EVQIMYHLAGQPNVVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRT 168

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + E ++  H    IH D+K
Sbjct: 169 IVEIIHTCHSLGVIHRDLK 187


>12_01_0778 +
           7111562-7112152,7113034-7113157,7113252-7113395,
           7113485-7113630,7113716-7113838,7113922-7114089,
           7114253-7114474,7114572-7114745
          Length = 563

 Score = 34.7 bits (76), Expect = 0.088
 Identities = 14/79 (17%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + +  H N +++       +   +VM+  +  +LF+ +  +G  + +  + ++R 
Sbjct: 132 EVAIMRSLPAHANVVRLREAFEDADAVHLVMEVCEGGELFDRIVARGHYTERAAAAVMRT 191

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + + +   HK+  +H D+K
Sbjct: 192 IMDVVQHCHKNGVMHRDLK 210


>06_03_0084 -
           16386962-16387033,16387124-16387175,16387252-16387313,
           16387509-16387543,16387637-16387679,16388610-16388692,
           16388829-16388917,16390415-16390681,16391370-16391446,
           16391546-16391677,16391802-16391870,16392464-16392529,
           16392603-16392773,16392848-16392916,16393005-16393086,
           16393175-16393219,16393535-16393659,16394271-16394525,
           16396561-16396722
          Length = 651

 Score = 34.7 bits (76), Expect = 0.088
 Identities = 18/81 (22%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK--GELSHQLVSNII 65
           E++   L+ DHPN ++ Y +    +   ++M Y+        ++          +++ ++
Sbjct: 60  EVQTMSLI-DHPNLLRAYCSFTNGHQLWVIMPYMAAGSALHIMKTSFPDGFEEPVIATLL 118

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R++ +AL  LH    IH D+K
Sbjct: 119 REVLKALVYLHSQGHIHRDVK 139


>04_04_0786 -
           28052981-28053040,28053123-28053222,28053447-28053574,
           28053654-28053821,28053901-28054013,28054135-28054287,
           28054385-28054528,28054794-28055529
          Length = 533

 Score = 34.7 bits (76), Expect = 0.088
 Identities = 18/79 (22%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI + Q ++  PN  +    +   ++  +VM++    +LF+ +  KG  S +  + + R 
Sbjct: 139 EITILQHLSGQPNIAEFRGAYEDNDHVHLVMEFCSGGELFDRITAKGSYSERQAAAVCRD 198

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   ++  H    IH D+K
Sbjct: 199 ILTVVHVCHFMGVIHRDLK 217


>02_05_0393 + 28571232-28572254
          Length = 340

 Score = 34.7 bits (76), Expect = 0.088
 Identities = 19/83 (22%), Positives = 41/83 (49%), Gaps = 5/83 (6%)
 Frame = -3

Query: 235 IKVHQLMNDHPNFIKIY---FNHGFINNQVI--VMDYIDCPDLFETLQIKGELSHQLVSN 71
           ++V     DHP+ ++++     H    N+ +  V++Y+    L + L ++G L    ++ 
Sbjct: 89  LRVAAAAPDHPSVVRLHGVCVGHPVAGNRFVYLVLEYLPEGSLSDVL-VRGALPEPAIAG 147

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           + R +   L+ LH+    H D+K
Sbjct: 148 VTRCVLRGLSHLHRLGVAHGDVK 170


>02_01_0590 +
           4376785-4377009,4378153-4378407,4378514-4378641,
           4378738-4378779,4378875-4378956,4379035-4379103,
           4379180-4379350,4379430-4379495,4379777-4379845,
           4379928-4380056,4380845-4380881,4380906-4380997,
           4381541-4381602,4381855-4381918
          Length = 496

 Score = 34.7 bits (76), Expect = 0.088
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 3/87 (3%)
 Frame = -3

Query: 253 NFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYI---DCPDLFETLQIKGELSHQ 83
           N   +E+K+   + DH N +  Y +        I+M Y+    C  L ++   KG    +
Sbjct: 76  NHASEEVKMMSTI-DHDNLLGAYCSFTEGETLWIIMPYMAGGSCFHLMKSSYPKG-FDEK 133

Query: 82  LVSNIIRQLCEALNDLHKHNFIHNDIK 2
            ++ ++R+  E L  LH++  +H D+K
Sbjct: 134 FIAFVLRETLEGLAYLHRYALVHRDVK 160


>01_01_1098 -
           8691312-8692430,8692640-8693509,8694522-8696105,
           8696199-8696258,8696336-8696414,8696494-8696555,
           8697129-8697204,8697367-8697419,8698181-8698270,
           8698411-8698458
          Length = 1346

 Score = 34.7 bits (76), Expect = 0.088
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKV-HQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           ++E+++ H L  DHPN +K Y  +    +  ++++Y    DL   L+   +L    + ++
Sbjct: 44  LNEVRMLHSL--DHPNVLKFYSWYETSAHFWLILEYCVGGDLKGLLEQDKKLPENSIHDL 101

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
              L +AL  LH    I+ D+K
Sbjct: 102 AYDLVKALQFLHSQGIIYCDLK 123


>10_08_0781 +
           20509033-20509714,20510048-20510191,20510604-20510719,
           20511356-20511520,20511822-20512043,20512613-20512735
          Length = 483

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 18/79 (22%), Positives = 36/79 (45%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   ++   N + I   +       IVM+     +LF  +Q +G  S +  + +I+ 
Sbjct: 121 EIQIMHHLSGQKNIVTIKDTYEDEQAVHIVMELCAGGELFSKIQKRGHYSERKAAELIKI 180

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H H  +H D+K
Sbjct: 181 IVGIIETCHSHGVMHRDLK 199


>10_08_0603 -
           19120434-19120538,19121209-19121310,19121430-19121462,
           19122049-19122216,19122311-19122373,19122514-19122624,
           19122926-19123035,19123150-19123446,19123632-19123710,
           19123811-19123919,19124000-19124041,19124743-19124873,
           19126150-19126797
          Length = 665

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 17/80 (21%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIR 62
           E+K+ + ++ H N +K Y       N  I+M+  +  +L + +  + G  + +    I+ 
Sbjct: 229 EVKILKALSGHSNLVKFYDACEDALNVYIIMELCEGGELLDRILSRGGRYTEEDAKVIVE 288

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+   ++  H    +H D+K
Sbjct: 289 QILNVVSFCHLQGVVHRDLK 308


>07_03_1698 +
           28803971-28804534,28804614-28804696,28804780-28804900,
           28804982-28805155,28805245-28805349,28805439-28805765
          Length = 457

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 17/70 (24%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHP  +++ ++        +V+D+I+   LF  L  +G    +L      ++  A+  LH
Sbjct: 176 DHPFVVQLRYSFQTKYRLYLVLDFINGGHLFFQLYKQGLFREELARIYTAEIVSAVAHLH 235

Query: 31  KHNFIHNDIK 2
            +  +H D+K
Sbjct: 236 DNGIMHRDLK 245


>05_06_0042 -
           25131962-25132149,25132261-25132345,25132750-25132797,
           25133084-25133197,25133279-25133410,25134029-25134124,
           25134771-25135005,25135054-25135322,25135408-25135491,
           25136529-25136703,25138018-25138229
          Length = 545

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 16/66 (24%), Positives = 31/66 (46%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           D    +K+Y++        ++M+Y+   D+   L  K  L+       I +   A+  +H
Sbjct: 172 DSAFIVKLYYSFQDEEYLYLIMEYLPGGDMMTLLMRKDTLTEDEARFYIAETVLAIESIH 231

Query: 31  KHNFIH 14
           KH++IH
Sbjct: 232 KHSYIH 237


>03_02_0909 -
           12310460-12310759,12310882-12310989,12311099-12311272,
           12311370-12311490,12311569-12311651,12311754-12312420,
           12314073-12314440
          Length = 606

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 17/70 (24%), Positives = 34/70 (48%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHP  +++ ++        +V+D+I+   LF  L  +G    +L      ++  A+  LH
Sbjct: 333 DHPFVVQLRYSFQTKYRLYLVLDFINGGHLFFQLYQQGLFREELARIYTAEIVSAVAHLH 392

Query: 31  KHNFIHNDIK 2
            +  +H D+K
Sbjct: 393 ANGIMHRDLK 402


>01_05_0438 + 22142646-22143659,22144319-22144858
          Length = 517

 Score = 34.3 bits (75), Expect = 0.12
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETL--QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VMDY+  P L + L  ++ G L+      ++RQL   +  +H    IH DIK
Sbjct: 154 LVMDYVG-PSLADLLTHRLDGALTEAEARGVMRQLLAGVGQMHARGVIHRDIK 205


>05_07_0280 -
           28920864-28920971,28921076-28921175,28921267-28921394,
           28922013-28922180,28922280-28922395,28922584-28922736,
           28922904-28923047,28923401-28924133
          Length = 549

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 14/79 (17%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ +   +  H N +++   +   ++  +VM+  +  +LF+ +  +G  S +  + + R+
Sbjct: 138 EVHIMHHLTGHRNIVELRGAYEDRHSVNLVMELCEGGELFDRIIARGHYSERAAAALCRE 197

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   ++  H    +H D+K
Sbjct: 198 IVSVVHSCHSMGVMHRDLK 216


>05_05_0315 -
           24030695-24030787,24030896-24030995,24031120-24031247,
           24031350-24031517,24031626-24031741,24031773-24031896,
           24032085-24032254,24032255-24032999
          Length = 547

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 14/51 (27%), Positives = 27/51 (52%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+     +LF+ +  KG  +    S+++R + E ++  H    IH D+K
Sbjct: 144 LVMELCAGGELFDRIIAKGHYTEHAASSLLRTIVEIIHTCHSMGVIHRDLK 194


>02_04_0221 -
           21021886-21022144,21022227-21022345,21022681-21022920,
           21023064-21023171,21023272-21023331,21023991-21024066,
           21024155-21024360,21024722-21024784,21024925-21025012,
           21025515-21026015,21027206-21027603
          Length = 705

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 15/51 (29%), Positives = 25/51 (49%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           I ++Y+    + + L+  G     ++ N  RQ+   L  LH  N +H DIK
Sbjct: 372 IYLEYVSGGSIHKLLREYGPFKEPVIRNYTRQILSGLAYLHGRNTVHRDIK 422


>12_01_0217 +
           1647319-1648327,1648462-1648577,1648650-1648817,
           1648911-1649038,1649121-1649220,1649329-1649433
          Length = 541

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 15/79 (18%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++   ++  PN + +   +   +N  +VM+     +LF+ +  +G  + +  + ++R 
Sbjct: 131 EVQIMHHLSGQPNIVDLRGAYEDKHNVHLVMELCAGGELFDRIIARGHYTERAAAALLRA 190

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   ++  H    IH D+K
Sbjct: 191 IVGIVHTCHSMGVIHRDLK 209


>11_01_0216 +
           1693889-1694897,1695034-1695149,1695222-1695389,
           1695482-1695609,1695692-1695791,1696124-1696168
          Length = 521

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 15/79 (18%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++   ++  PN + +   +   +N  +VM+     +LF+ +  +G  + +  + ++R 
Sbjct: 131 EVQIMHHLSGQPNIVDLRGAYEDKHNVHLVMELCAGGELFDRIIARGHYTERAAAALLRA 190

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   ++  H    IH D+K
Sbjct: 191 IVGIVHTCHSMGVIHRDLK 209


>09_03_0166 +
           12956794-12956832,12956936-12956977,12957084-12957149,
           12957237-12957350,12957435-12957515,12957613-12957690,
           12958702-12958784,12959645-12959726,12959801-12959901,
           12960016-12960055,12960162-12960221,12960302-12960348,
           12960437-12960575,12960716-12960931,12961010-12961344,
           12961525-12961596,12962449-12962589,12962680-12962716,
           12962837-12963256
          Length = 730

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 19/81 (23%), Positives = 40/81 (49%), Gaps = 1/81 (1%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           +E+K+ + ++ HPN +K Y       + + I+++++    +   L   G     ++    
Sbjct: 35  EEVKLLKNLS-HPNIVKRYLGTVREEDTLNILLEFVPGGSIQSLLGKLGSFPEAVIRKYT 93

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +Q+ + L  LH +  IH DIK
Sbjct: 94  KQILQGLEYLHNNAIIHRDIK 114


>07_03_1293 -
           25563431-25563545,25564078-25564196,25564300-25564467,
           25564565-25564627,25564709-25564816,25565125-25565237,
           25565313-25565609,25565724-25565802,25566116-25566224,
           25566324-25566365,25567023-25567153,25568100-25568648
          Length = 630

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 17/80 (21%), Positives = 39/80 (48%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIR 62
           E+K+ + +  H N ++ Y  +   +N  IVM+  +  +L + +  + G+ S      ++ 
Sbjct: 196 EVKILKALAGHKNLVQFYDAYEDNDNVYIVMELCEGGELLDRILSRGGKYSEDDAKAVLV 255

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+   ++  H    +H D+K
Sbjct: 256 QILNVVSFCHIQGVVHRDLK 275


>04_04_1028 +
           30230224-30231274,30231500-30231609,30232144-30232170,
           30233107-30234252
          Length = 777

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DHPN +K+       N  ++V ++I    LF+ +  +  L  +    I  +  EAL+ LH
Sbjct: 499 DHPNVVKLLGCCLETNVPLLVYEFIPNGTLFQHIHNRSSLRWEDCLRIAEETAEALDYLH 558

Query: 31  KHN---FIHNDIK 2
             +    IH DIK
Sbjct: 559 STSSTPIIHRDIK 571


>02_05_0011 + 24953472-24954506
          Length = 344

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIK--GELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VMD    PDL + ++++    +   + + ++ QL EAL   H+    H D+K
Sbjct: 99  MVMDLCSGPDLLDWIRLRRGAPVPEPVAAAVVAQLAEALAHCHRRGVAHRDVK 151


>01_05_0743 +
           24835349-24836009,24836925-24837068,24837154-24837306,
           24837627-24837742,24837826-24837993,24838610-24838737,
           24838827-24838926,24839119-24839205
          Length = 518

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 13/79 (16%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++   +  H N +++   +   ++  ++M+  +  +LF+ +  +G  S +  + + R+
Sbjct: 114 EVQIMHHLTGHRNIVELRGAYEDRHSVNLIMELCEGGELFDRIIARGHYSERAAAALCRE 173

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   ++  H     H D+K
Sbjct: 174 IVAVVHSCHSMGVFHRDLK 192


>07_03_1686 + 28657337-28658668
          Length = 443

 Score = 33.1 bits (72), Expect = 0.27
 Identities = 16/50 (32%), Positives = 22/50 (44%)
 Frame = -3

Query: 151 VMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           V+D     +LF  L   G ++  L  +  RQL  A+   H     H DIK
Sbjct: 117 VLDLAAGGELFSLLDASGRMTEDLARHYFRQLISAVRYCHSRGVYHRDIK 166


>07_03_1308 +
           25662851-25662855,25663946-25663977,25664400-25664599,
           25665676-25665750,25666913-25667014,25667097-25667150,
           25667236-25667328,25667411-25667503,25667586-25667690,
           25667981-25668259
          Length = 345

 Score = 33.1 bits (72), Expect = 0.27
 Identities = 25/95 (26%), Positives = 39/95 (41%), Gaps = 1/95 (1%)
 Frame = -3

Query: 283 IVFAENNFGANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ 107
           + F E     + NV  EI  H+ +  HPN ++         +  IVM+Y    +LFE + 
Sbjct: 71  VKFIERGQKIDENVQREIMNHRSLR-HPNIVRFKEVVLTPTHLAIVMEYAAGGELFERIC 129

Query: 106 IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
             G  S        +QL   ++  H     H D+K
Sbjct: 130 SAGRFSEDEARFFFQQLISGVSYCHSMQICHRDLK 164


>07_03_0536 -
           19205515-19205686,19205807-19205931,19206428-19206554,
           19206653-19206777,19207616-19207708,19207779-19208052,
           19208138-19208269,19208391-19208470,19209049-19209117,
           19209227-19209343,19209416-19209484,19209839-19209892,
           19210012-19210049,19211243-19211354,19211497-19211619,
           19211728-19211755,19212048-19212104,19212984-19213028,
           19213340-19213361,19213817-19213844,19214338-19214418
          Length = 656

 Score = 33.1 bits (72), Expect = 0.27
 Identities = 18/51 (35%), Positives = 26/51 (50%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           IVM+Y+    + + LQ    L    ++ I+R L  A+  LH    IH DIK
Sbjct: 115 IVMEYMAGGSVADLLQTGPPLDELSIACILRDLLHAVEYLHSEGKIHRDIK 165


>03_03_0059 +
           14149796-14150350,14152303-14152433,14153479-14153520,
           14153632-14153740,14154262-14154340,14154437-14154733,
           14154820-14154932,14155375-14155482,14155554-14155616,
           14155698-14155865,14156283-14156348
          Length = 576

 Score = 33.1 bits (72), Expect = 0.27
 Identities = 17/80 (21%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNIIR 62
           E+++   +  H N ++ Y  +    N  IVM+     +L + +  +G + S +    ++R
Sbjct: 198 EVRILSSLAGHSNLVQFYDAYEDEENVYIVMELCKGGELLDRILARGGKYSEEDAKVVMR 257

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+    +  H    +H D+K
Sbjct: 258 QILSVASFCHLQGVVHRDLK 277


>03_01_0202 +
           1605703-1606402,1606681-1606824,1606911-1607063,
           1607236-1607351,1607737-1607904,1607990-1608214,
           1608711-1608833
          Length = 542

 Score = 33.1 bits (72), Expect = 0.27
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   ++ H N + I   +       IVM+     +LF+ +Q KG  S +  + +IR 
Sbjct: 127 EIQIMHHLSGHKNVVAIKDVYEDGQAVHIVMELCAGGELFDRIQEKGHYSERKAAELIRI 186

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    +H D+K
Sbjct: 187 IVSIVAMCHSLGVMHRDLK 205


>12_02_0370 +
           18139557-18140469,18140561-18140704,18140804-18140956,
           18141032-18141147,18141231-18141398,18142110-18142334,
           18142458-18142577
          Length = 612

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 18/79 (22%), Positives = 35/79 (44%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +  HPN I I   +       +VM+     +LF+ +  KG  + +  + + R 
Sbjct: 198 EIQIMHHLAGHPNIISIRGAYEDAVAVHVVMELCAGGELFDRIVRKGHYTERQAAGLARV 257

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    +H D+K
Sbjct: 258 IVAVVESCHSLGVMHRDLK 276


>04_04_1659 -
           35127145-35127204,35127324-35127464,35127597-35127647,
           35127757-35127837,35128229-35128324,35128393-35128568,
           35130088-35130176,35130255-35130362,35130673-35130809,
           35131023-35131073,35131264-35131310,35131477-35131544,
           35132161-35132262,35132556-35132735,35132821-35133059
          Length = 541

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDL 35
           DH N ++ Y         +IV +Y+   +L++ L  +   L   +V  I   + + ++ L
Sbjct: 319 DHENVVQFYGACTKHRKYLIVTEYMPGGNLYDFLHKQNNTLELPVVLRIAIGISKGMDYL 378

Query: 34  HKHNFIHNDIK 2
           H++N IH D+K
Sbjct: 379 HQNNIIHRDLK 389


>03_06_0273 +
           32787021-32787434,32788096-32788221,32788305-32788378,
           32788468-32788537,32788622-32788677,32788762-32788833,
           32788945-32789039,32789196-32789262,32789359-32789488,
           32789578-32789793,32789887-32790017,32790719-32790893,
           32790977-32791067,32792151-32792308,32792763-32792951,
           32793066-32793125
          Length = 707

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 21/88 (23%), Positives = 41/88 (46%), Gaps = 2/88 (2%)
 Frame = -3

Query: 259 GANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSH 86
           G N+    E +V+  +N       +++     +  ++VMD +  P L++     G+ +S 
Sbjct: 192 GCNYGPPYEWQVYHTLNGCYGIPSVHYKGRLGDYYILVMDMLG-PSLWDVWNSVGQAMSA 250

Query: 85  QLVSNIIRQLCEALNDLHKHNFIHNDIK 2
            +V+ I  +    L  LH   F+H D+K
Sbjct: 251 HMVACIAVEAISILEKLHSKGFVHGDVK 278


>12_02_0929 -
           24493168-24493458,24493545-24493643,24493768-24493872,
           24494101-24494193,24494438-24494530,24494646-24494699,
           24494816-24494917,24495058-24495132,24495245-24495418
          Length = 361

 Score = 32.3 bits (70), Expect = 0.47
 Identities = 22/79 (27%), Positives = 33/79 (41%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI  H+ +  HPN I+         +  IVM+Y    +LFE +   G  S        +Q
Sbjct: 66  EIINHRSLR-HPNIIRFKEVILTPTHLAIVMEYASGGELFERICSAGRFSEDEARFFFQQ 124

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   ++  H     H D+K
Sbjct: 125 LISGVSYCHSMQVCHRDLK 143


>04_04_1457 -
           33741048-33741146,33741647-33741760,33741938-33742052,
           33742154-33742560,33743342-33743476,33743576-33743970,
           33744225-33744916,33745014-33745097,33745195-33745286,
           33745374-33745457,33745535-33745714,33746258-33746302,
           33746399-33746692,33747199-33747585,33747713-33747899,
           33748042-33748118,33748936-33749067,33749315-33749416,
           33749744-33749827,33749902-33749992,33750105-33750178,
           33750644-33750664,33751433-33751477,33752427-33752561,
           33752693-33752752
          Length = 1376

 Score = 32.3 bits (70), Expect = 0.47
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK--GELSHQLVSNIIRQLCEALND 38
           +H N +K   +    ++  I+++Y++   L   ++    G     LV+  I Q+ E L  
Sbjct: 90  NHKNIVKYLGSLKTRSHLHIILEYVENGSLANIIKPNKFGPFPESLVAVYIAQVLEGLVY 149

Query: 37  LHKHNFIHNDIK 2
           LH+   IH DIK
Sbjct: 150 LHEQGVIHRDIK 161


>03_05_0297 -
           22870052-22870342,22870436-22870534,22870624-22870728,
           22870898-22870990,22871206-22871298,22871449-22871502,
           22871604-22871957
          Length = 362

 Score = 31.9 bits (69), Expect = 0.62
 Identities = 22/79 (27%), Positives = 33/79 (41%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI  H+ +  HPN I+         +  IVM+Y    +LFE +   G  S        +Q
Sbjct: 67  EIINHRSLR-HPNIIRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQ 125

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   ++  H     H D+K
Sbjct: 126 LISGVSYCHSMQVCHRDLK 144


>03_02_0444 -
           8543426-8543635,8543945-8544151,8544293-8544400,
           8544744-8544803,8544914-8544989,8545190-8545347,
           8545479-8545541,8545653-8545737,8546423-8547438
          Length = 660

 Score = 31.9 bits (69), Expect = 0.62
 Identities = 20/70 (28%), Positives = 30/70 (42%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +H N ++ Y      +   I ++ +    L    Q K  L    VS   RQ+   L  LH
Sbjct: 376 EHENIVQYYGTDKEDSKLYIFLELVTQGSLASLYQ-KYRLRDTHVSAYTRQILNGLTYLH 434

Query: 31  KHNFIHNDIK 2
           + N +H DIK
Sbjct: 435 ERNIVHRDIK 444


>02_05_0882 +
           32477306-32478189,32478735-32478819,32478930-32478992,
           32479177-32479334,32479460-32479535,32479622-32479681,
           32479978-32480082,32480450-32480629
          Length = 536

 Score = 31.9 bits (69), Expect = 0.62
 Identities = 20/70 (28%), Positives = 31/70 (44%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +H N ++ YF     + ++ +   +        L  K  L    VS   RQ+   LN LH
Sbjct: 332 EHENIVQ-YFGTDKEDGKLYIFLELVTQGSLAALYQKYRLQDSQVSAYTRQILIGLNYLH 390

Query: 31  KHNFIHNDIK 2
           + N +H DIK
Sbjct: 391 QRNVLHRDIK 400


>03_05_0885 -
           28505628-28505767,28505892-28505970,28506048-28506163,
           28506588-28506654,28507361-28507456,28508729-28508838,
           28508983-28509070,28510109-28510183,28510401-28510445,
           28510521-28510595,28511392-28511763
          Length = 420

 Score = 31.5 bits (68), Expect = 0.82
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           E+ + +++ DHPN + +    +    +   +V++Y++       +     L      N +
Sbjct: 189 EVSIMKML-DHPNIVNLIEVIDDPNADKFYMVLEYVE-----GKMVCDNGLGEATSRNYL 242

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R +   +  LH HN IH DIK
Sbjct: 243 RDIISGVMYLHSHNIIHGDIK 263


>03_05_0835 -
           28065505-28065656,28066547-28066604,28067535-28067642,
           28067796-28067855,28067940-28068015,28068470-28068627,
           28068787-28068849,28069003-28069142,28070793-28071882
          Length = 634

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 20/70 (28%), Positives = 31/70 (44%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +H N ++ Y      +   I ++ +    L    Q K +L    VS   RQ+   L  LH
Sbjct: 419 EHENIVQYYGTDKEESKLYIFIELVTQGSLSSLYQ-KYKLRDSQVSAYTRQILNGLVYLH 477

Query: 31  KHNFIHNDIK 2
           + N +H DIK
Sbjct: 478 ERNVVHRDIK 487


>09_04_0136 + 14972687-14973901
          Length = 404

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 16/79 (20%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI V ++++ HP+ ++++          + ++ +   +LF+ +   G +   +     RQ
Sbjct: 59  EIAVMKMVS-HPSVVELHEVMATRTKVYLALELVRGGELFDRIARHGRVGEGVARRYFRQ 117

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A++  H     H D+K
Sbjct: 118 LVSAVDFCHGRGVYHRDLK 136


>07_03_1452 -
           26629219-26629428,26630113-26630280,26630363-26630425,
           26630499-26630606,26630820-26630932,26631026-26631322,
           26631424-26631502,26631733-26631841,26631927-26631968,
           26632467-26632597,26633482-26633623,26633713-26633828,
           26634121-26634657
          Length = 704

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 16/80 (20%), Positives = 37/80 (46%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIR 62
           E+++   +  H N ++ Y      +N  IVM+     +L + +  + G+ S +    ++ 
Sbjct: 278 EVRILSSLTGHSNLVQFYDAFEDEDNVYIVMELCKGGELLDRILARGGKYSEEDAKVVMV 337

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+   ++  H    +H D+K
Sbjct: 338 QILSVVSFCHLQGVVHRDLK 357


>03_02_0608 -
           9818020-9818192,9818723-9818906,9818991-9819323,
           9819455-9819592,9819707-9819836,9820151-9820266
          Length = 357

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 6/95 (6%)
 Frame = -3

Query: 268 NNFGANFNVDEIKVHQLMNDHPNFIKIY------FNHGFINNQVIVMDYIDCPDLFETLQ 107
           N+  A   + EIK+ + + DH N I I           F N+  I  + +D  DL   ++
Sbjct: 61  NDMDAKRTLREIKLLRHL-DHENIIGIRDVIPPPIPQAF-NDVYIATELMDT-DLHHIIR 117

Query: 106 IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
              ELS +     + Q+   L  +H  N IH D+K
Sbjct: 118 SNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLK 152


>01_06_0872 +
           32609792-32610178,32611262-32611387,32611477-32611550,
           32611944-32612013,32612088-32612143,32612236-32612307,
           32612384-32612478,32612660-32612726,32612809-32612938,
           32613135-32613350,32613461-32613591,32614044-32614218,
           32614292-32614382,32614653-32614810,32615059-32615247,
           32615551-32615564,32616003-32616228
          Length = 758

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
 Frame = -3

Query: 268 NNFGANFNVD-EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE- 95
           N+ G N+    E +V+  +N       +++     +  V+VMD +  P L++     G+ 
Sbjct: 180 NSKGCNYGPPYEWQVYSALNGCYGIPWVHYKGRQGDYYVLVMDILG-PSLWDVWNSVGQT 238

Query: 94  LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++  +V+ I  +    L  LH   F+H D+K
Sbjct: 239 MTPSMVACIAVEAISILEKLHAKGFVHGDVK 269


>09_06_0347 +
           22445962-22446154,22446495-22446616,22446764-22446885,
           22447405-22447594,22447874-22448014,22448257-22448724,
           22448842-22449609,22450185-22450373
          Length = 730

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 6/75 (8%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE---LSHQLVSNIIRQLCEALND 38
           HPN + +       + + +V +Y+    L + L  K     LS QL + I   +C AL  
Sbjct: 421 HPNLVTLI--GACKDARALVYEYMPNGSLDDRLACKDNSKPLSWQLRTRIASNICSALIF 478

Query: 37  LHK---HNFIHNDIK 2
           LH    H+ +H+D+K
Sbjct: 479 LHSNKPHSIVHSDLK 493


>03_06_0235 +
           32539025-32539886,32540330-32540473,32540595-32540747,
           32540871-32540986,32541254-32541421,32541534-32541758,
           32541884-32542015
          Length = 599

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 18/79 (22%), Positives = 35/79 (44%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +  HPN I I   +       +VM+     +LF+ +  KG  + +  + + R 
Sbjct: 181 EIQIMYHLAGHPNVISIRGAYEDAVAVHLVMELCAGGELFDRIVQKGHYTERKAAELARV 240

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    +H D+K
Sbjct: 241 IVGVVEVCHSMGVMHRDLK 259


>02_05_1008 - 33461225-33462334
          Length = 369

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 17/70 (24%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +HP  ++ +  +       I+++Y+D   L E  +I  E     ++++ RQ+   +  LH
Sbjct: 147 EHPAVVRCHGMYEQAGELQILLEYMDGGSL-EGRRIASEA---FLADVARQVLSGIAYLH 202

Query: 31  KHNFIHNDIK 2
           + + +H DIK
Sbjct: 203 RRHIVHRDIK 212


>09_06_0146 +
           21186889-21187178,21187321-21187435,21188595-21188686,
           21188839-21188952,21189139-21189193,21189348-21189458,
           21190226-21190279,21190362-21190537,21190623-21190730,
           21191332-21191405,21191500-21191675,21192169-21192264,
           21192534-21192614,21192713-21192766,21193246-21193380,
           21193453-21193533
          Length = 603

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 14/55 (25%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = -3

Query: 163 NQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N  IV +Y+    +++ L + KG      +  ++  + + ++ LH++N IH D+K
Sbjct: 391 NLCIVTEYMSGGSVYDYLHKHKGVFKLPALLGVVMDVSKGMSYLHQNNIIHRDLK 445


>08_02_0813 + 21459776-21461128
          Length = 450

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 14/69 (20%), Positives = 30/69 (43%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++      +   + ++ +   +LF  +   G +      +  RQL  A++  H 
Sbjct: 79  HPNIVELHEVMATRSKIYLALELVRGGELFGRIVRLGRVREDAARHYFRQLVSAVDFCHS 138

Query: 28  HNFIHNDIK 2
               H D+K
Sbjct: 139 RGVYHRDLK 147


>05_07_0010 -
           27024013-27024171,27024286-27024699,27025389-27025445,
           27025544-27025637,27025775-27025868,27025949-27026117,
           27026450-27026554,27026665-27026784,27027190-27027735
          Length = 585

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = -3

Query: 88  HQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++++  ++RQL  AL+ LH    +H D+K
Sbjct: 277 NKIIQTVMRQLLFALDGLHSTGIVHRDVK 305


>02_01_0279 -
           1860410-1860508,1861536-1861889,1862660-1862805,
           1862885-1862925,1863010-1863173,1863217-1863281,
           1863410-1863670,1863754-1863817,1863946-1864006,
           1864112-1864473
          Length = 538

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIV-MDYID-CPDLFETLQIK-GELSHQLVS 74
           V E++    +  H N +  YF   F N Q+ + M+  D C  +     +K GE       
Sbjct: 330 VKEVQALAALGCHENIVG-YFTSWFENKQLFIQMELCDRCLSMDRNQPLKCGE-----AL 383

Query: 73  NIIRQLCEALNDLHKHNFIHNDIK 2
            ++ Q+C+ L+ +H+    H D+K
Sbjct: 384 ELLYQICKGLDFIHERGIAHLDVK 407


>10_08_0939 +
           21696941-21697049,21697171-21697255,21698385-21698457,
           21698553-21698609,21698660-21698713,21699196-21699246,
           21699441-21699503,21700453-21700518,21700625-21700663,
           21702190-21702271,21703479-21703536,21703698-21703914,
           21704248-21704697
          Length = 467

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 9/22 (40%), Positives = 15/22 (68%)
 Frame = -3

Query: 439 IYDSSWPPPPPQMYAANAGTIL 374
           ++ ++WPP PP     N+GTI+
Sbjct: 273 LFPATWPPMPPMAPTTNSGTII 294


>03_06_0065 -
           31399791-31399874,31399956-31400165,31400407-31400526,
           31401166-31401225,31401670-31401879,31402512-31402587,
           31403010-31403173,31403254-31403316,31403640-31403727,
           31403810-31404460,31405102-31405149,31405334-31405902
          Length = 780

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 15/70 (21%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLH 32
           H N ++ Y +    +   I ++Y+    + + + Q  G ++  ++ +  R + + L  LH
Sbjct: 462 HENIVQYYGSEYIEDRFYIYLEYVHPGSINKYVNQHCGAMTESVIRSFTRHILKGLAFLH 521

Query: 31  KHNFIHNDIK 2
               +H DIK
Sbjct: 522 SQKIMHRDIK 531


>03_06_0003 +
           30921197-30921388,30921514-30921632,30921742-30921811,
           30922078-30922161,30922258-30922344,30922431-30922501,
           30922648-30922702,30923374-30923509,30925009-30925103,
           30925203-30925357,30925435-30925543,30925761-30925817,
           30925913-30926027,30926177-30926264,30926738-30927501,
           30927600-30927688,30928315-30928422,30928550-30928657,
           30928887-30928977,30929235-30929287,30929557-30929712,
           30930763-30930825,30931491-30931535,30932075-30932130,
           30933051-30933132,30933238-30933354,30933428-30933530,
           30933912-30934062,30934180-30934417,30934564-30934764,
           30934850-30934935,30935036-30935135
          Length = 1347

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNIIRQLCEALNDLH 32
           HPN ++ + ++       IVM+Y     + + + I  E L    ++ I R+  + L  LH
Sbjct: 781 HPNVVRYFGSYQGEEYLWIVMEYCGGGSVADLIGITEEPLDESQIAYICREALKGLAYLH 840

Query: 31  KHNFIHNDIK 2
               +H DIK
Sbjct: 841 SIFKVHRDIK 850


>02_05_0340 +
           28105222-28105960,28106844-28106987,28107083-28107235,
           28107418-28107533,28107819-28107986,28108792-28109016,
           28110445-28110483,28110497-28110592
          Length = 559

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 18/79 (22%), Positives = 35/79 (44%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +  H N + I   +       IVM+     +LF+ +  +G+ S +  + + R 
Sbjct: 140 EIQIMHHLAGHRNVVAIKGAYEDPQYVHIVMELCAGGELFDRIIERGQFSERKAAELTRI 199

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    IH D+K
Sbjct: 200 IVGVIEACHSLGVIHRDLK 218


>02_01_0176 +
           1207792-1208081,1208212-1208329,1208495-1208668,
           1209588-1209751,1209861-1209948,1210125-1210178,
           1210798-1210884
          Length = 324

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 13/52 (25%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGEL-SHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +V +Y+D  DL + +    +  +H++V + + Q+   +   H H  +H D+K
Sbjct: 110 LVFEYLDL-DLKKHMDSSPDFKNHRIVKSFLYQILRGIAYCHSHRVLHRDLK 160


>01_06_1163 - 35018862-35019623,35019702-35019951,35020871-35020929
          Length = 356

 Score = 29.5 bits (63), Expect = 3.3
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = -3

Query: 439 IYDSSWPPPPPQMYAANAGTILRKLQKRQNSV*N 338
           ++ ++WPP PP   A N+GT   + + +   V N
Sbjct: 47  LFPATWPPMPPMAPATNSGTTHARSRSKAKPVIN 80


>07_01_0437 -
           3322132-3322251,3322345-3322569,3322953-3323120,
           3323207-3323322,3323394-3323546,3323655-3323798,
           3324475-3325255
          Length = 568

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 16/79 (20%), Positives = 35/79 (44%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +  HP+ + I   +       +VM+     +LF+ +  +G  S +  + + R 
Sbjct: 154 EIQIMHHLAGHPSVVSIVGAYEDAVAVHLVMELCAGGELFDRIVQRGHYSEKAAAQLARV 213

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    +H D+K
Sbjct: 214 IIGVVEACHSLGVMHRDLK 232


>03_06_0068 +
           31439486-31439692,31441378-31441452,31441540-31441641,
           31441739-31441792,31441888-31441980,31442224-31442316,
           31443007-31443111,31443217-31443315,31444165-31444452
          Length = 371

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 21/79 (26%), Positives = 32/79 (40%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI  H+ +  HPN I+         +  IVM+Y    +LFE +      S        +Q
Sbjct: 77  EIINHRSLK-HPNIIRFKEVILTPTHLAIVMEYASGGELFERICKNVRFSEDEARYFFQQ 135

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   ++  H     H D+K
Sbjct: 136 LISGVSYCHSMQVCHRDLK 154


>03_01_0150 +
           1191410-1191697,1191818-1191941,1192063-1192121,
           1192565-1192629,1192838-1192931,1193005-1193085,
           1193176-1193287,1193949-1194036,1194440-1194561,
           1194636-1194973,1195579-1195870,1195946-1196016,
           1197741-1197849,1198760-1198803,1198804-1198847,
           1200431-1200524
          Length = 674

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 4/73 (5%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG----ELSHQLVSNIIRQLCEALN 41
           HPN +++  +     N  ++++Y +  DL E  + KG     L      + +RQL E L 
Sbjct: 85  HPNILRL-IDTIQEENLYLILEYCNGGDL-EGYRTKGGEDARLPDATARDFMRQLAEGLK 142

Query: 40  DLHKHNFIHNDIK 2
            L   + +H D+K
Sbjct: 143 MLRGRSIVHRDLK 155


>04_04_1689 +
           35379627-35379746,35379823-35380344,35380428-35380526,
           35380608-35380979
          Length = 370

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQ--VIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           EI  H+ +  HPN I+  F    +  +   IVM+Y    +LFE +   G           
Sbjct: 48  EIVNHRSLR-HPNIIR--FKEVVVTGRHLAIVMEYAAGGELFERICEAGRFHEDEARYFF 104

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           +QL   ++  H     H D+K
Sbjct: 105 QQLVCGVSYCHAMQICHRDLK 125


>04_03_0983 +
           21423086-21423280,21423330-21423404,21423531-21423632,
           21423721-21423774,21423880-21423972,21424526-21424618,
           21427329-21427433,21427517-21427615,21427701-21427997,
           21428512-21428622
          Length = 407

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 21/85 (24%), Positives = 35/85 (41%), Gaps = 4/85 (4%)
 Frame = -3

Query: 244 VDEIKVHQLMND----HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           +DE    +++N     HPN I+         +  IVM+Y    +LF+ +   G  S    
Sbjct: 66  IDENVAREIINHRSLRHPNIIRFKEVVVTPTHLAIVMEYAAGGELFDRICNAGRFSEDEA 125

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
               +QL   ++  H     H D+K
Sbjct: 126 RYFFQQLICGVSYCHFMQICHRDLK 150


>03_05_0675 + 26630466-26632070
          Length = 534

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ--IKGELSHQLVSNII 65
           E K   L++ H N ++ + +    ++  +VM ++    L   L       L  Q ++ ++
Sbjct: 75  EAKAMALLS-HRNVLRAHCSFTVGSHLWVVMPFMAAGSLHSILSHGFPDGLPEQCIAVVL 133

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           R    AL  LH+   IH DIK
Sbjct: 134 RDTLRALCYLHEQGRIHRDIK 154


>01_06_1485 +
           37703696-37703815,37703970-37704044,37704598-37704699,
           37704792-37704845,37705030-37705122,37705215-37705307,
           37707150-37707254,37707356-37707454,37707558-37707899
          Length = 360

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 20/79 (25%), Positives = 35/79 (44%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI  H+ +  HPN I+         + +IVM++    +LF+ +  +G  S        +Q
Sbjct: 48  EIINHRSLR-HPNIIRFKEVILTPTHLMIVMEFAAGGELFDRICDRGRFSEDEARYFFQQ 106

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L   ++  H     H D+K
Sbjct: 107 LICGVSYCHHMQICHRDLK 125


>01_06_0453 + 29501600-29502403
          Length = 267

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
 Frame = +2

Query: 446 LYNLIYSIIGTIKLM-HINFLNRRYCGSANYQRQHLRQHSVAEQRCFFKY 592
           L+ L+  +IGTI L    +   R++    +Y+ QH   H    QRC  +Y
Sbjct: 26  LFLLLNVVIGTIALTSRASHRRRQHHHDEHYKAQHHHDHHDEPQRCHDQY 75


>06_01_0636 + 4627533-4628546
          Length = 337

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 16/70 (22%), Positives = 37/70 (52%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           +HP  ++ +  +       I+++Y+D   L +  +I  E   + ++++ RQ+   +  LH
Sbjct: 119 EHPAVVRCHDMYERGGELQILLEYMDGGSL-DGRRIADE---RFLADVARQVLSGIAYLH 174

Query: 31  KHNFIHNDIK 2
           + + +H DIK
Sbjct: 175 RRHIVHRDIK 184


>05_01_0268 -
           2053420-2053539,2053636-2053710,2053805-2053867,
           2053977-2054093,2054332-2054436,2054559-2054768,
           2054858-2054983,2055061-2055114,2055198-2055278,
           2055419-2055526,2055579-2055719,2056396-2056629
          Length = 477

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 11/38 (28%), Positives = 21/38 (55%)
 Frame = -3

Query: 115 TLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           T+ +KG+LS +    + +QL + ++  H     H D+K
Sbjct: 124 TMAVKGKLSEKEGRRLFQQLIDGVSYCHDRGVYHRDLK 161


>03_06_0239 -
           32578231-32578353,32578431-32578655,32579081-32579248,
           32579331-32579446,32579540-32579692,32579779-32579922,
           32580775-32581576
          Length = 576

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 16/79 (20%), Positives = 34/79 (43%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI++   +  H N + I   +       +VM+     +LF+ +  +G  S +  + + R 
Sbjct: 161 EIQIMHHLAGHANVVSIVGAYEDAVAVQLVMELCAGGELFDRIIQRGHYSEKAAAQLARV 220

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   +   H    +H D+K
Sbjct: 221 IVGVIEACHSLGVMHRDLK 239


>01_06_1662 -
           38974803-38974895,38975118-38975256,38976044-38976117,
           38976197-38976308,38976418-38976479,38976996-38977337
          Length = 273

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 6/57 (10%)
 Frame = -3

Query: 154 IVMDYIDCPDL--FETLQIKGELSHQLVSNIIR----QLCEALNDLHKHNFIHNDIK 2
           +V +++D  DL  F     KG     L +N+I+    QLC+ +   H H  +H D+K
Sbjct: 83  LVFEFLDT-DLKKFVDAYRKGPNPRPLPTNVIKSFLYQLCKGVAHCHGHGVLHRDLK 138


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,494,336
Number of Sequences: 37544
Number of extensions: 362802
Number of successful extensions: 1770
Number of sequences better than 10.0: 112
Number of HSP's better than 10.0 without gapping: 1619
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1753
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2209429392
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -