SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120042.Seq
         (745 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_0772 + 24483314-24486781,24487148-24487240,24488366-24488458     29   2.9  
01_01_0034 - 269356-270333,270809-270897,273621-273957                 29   5.2  
05_05_0038 - 21769936-21770199,21770785-21771198,21771274-217714...    23   7.6  
02_01_0311 - 2075881-2076165,2076450-2076519,2076628-2076691,207...    28   9.0  

>06_03_0772 + 24483314-24486781,24487148-24487240,24488366-24488458
          Length = 1217

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = -3

Query: 413 FRTNWFN*HALVHVVGVENCFSRLGLIVAQQVPIIQFCVLV*KHAV*HGHVQHSFSLSG 237
           F TNW    AL  V+ +ENC   + L    Q+P+++  VL   HAV  G +   F  +G
Sbjct: 788 FETNWMK--ALTSVI-LENCMGWVQLPPLGQLPLLEDLVLRNMHAV--GQIGEEFYGNG 841


>01_01_0034 - 269356-270333,270809-270897,273621-273957
          Length = 467

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = -1

Query: 280 LFNTVMCNIRFRYRDLNNCYVDALLCNSLV 191
           + N ++CN+RF  +D++N  V  L C  +V
Sbjct: 124 IINVILCNVRFERQDMDNT-VTQLGCGGMV 152


>05_05_0038 -
           21769936-21770199,21770785-21771198,21771274-21771434,
           21771544-21771607,21771682-21771864,21772355-21772520,
           21773397-21773528,21775085-21775599
          Length = 632

 Score = 23.4 bits (48), Expect(2) = 7.6
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +2

Query: 623 DSESGQSVDVCNELQYPWNL-ITANSFNVSTDESRQS 730
           DSES   + V +ELQ   NL +  N  +V  D+ + +
Sbjct: 488 DSESRDDIIVADELQVDDNLAVMQNESSVREDDKKST 524



 Score = 23.0 bits (47), Expect(2) = 7.6
 Identities = 6/27 (22%), Positives = 16/27 (59%)
 Frame = +2

Query: 485 QVHWQTGRDEYILIADRMYVDLIYSEF 565
           ++HWQ GR+  +   +   + ++Y ++
Sbjct: 427 KLHWQNGRNRSVQTGETANILVVYEDW 453


>02_01_0311 -
           2075881-2076165,2076450-2076519,2076628-2076691,
           2076798-2076837,2076930-2077006,2077095-2077311,
           2077482-2078132
          Length = 467

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = -1

Query: 448 LCSPASSTLLKCSVRIGLINTHSYTSSAL 362
           LC   +ST L C+++   I T S +SS+L
Sbjct: 41  LCGSTNSTSLSCAIQSSNIKTESISSSSL 69


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,082,670
Number of Sequences: 37544
Number of extensions: 327258
Number of successful extensions: 824
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 807
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 824
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1968901276
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -