SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120040.Seq
         (757 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0741 - 22690452-22690528,22690693-22690813,22690871-226909...    30   2.3  
11_06_0337 - 22454281-22456399,22458520-22459388                       30   2.3  
03_02_0857 + 11839400-11839633,11839665-11839787,11839846-11840259     29   3.0  
10_08_0639 + 19505934-19506088,19506584-19506633,19508153-195088...    28   7.0  
08_02_1480 + 27401923-27402158,27402847-27402982,27403119-274031...    28   7.0  
06_02_0086 - 11567390-11567634,11568316-11568341,11571082-115712...    28   7.0  
03_01_0612 - 4501595-4501619,4501752-4501906,4502051-4502092,450...    28   7.0  
04_03_0627 + 18147789-18148052,18148492-18148955,18149863-18150043     28   9.2  

>12_02_0741 -
           22690452-22690528,22690693-22690813,22690871-22690951,
           22691048-22691096,22691324-22691409,22691494-22691571,
           22691647-22691796,22691884-22691922,22692194-22692283,
           22692568-22692630,22692722-22692791,22693109-22693155,
           22693268-22693330,22693411-22693461,22693702-22693785,
           22693932-22693996,22694322-22694378,22694452-22694569,
           22694664-22694714,22694789-22694875,22694956-22695035,
           22695962-22696127
          Length = 590

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 17/63 (26%), Positives = 30/63 (47%)
 Frame = -3

Query: 290 VHRLLILFCRANVVLARNASYRTRNVKHHENGFCQLRVHNLVNVHQLSGLFVHMTISNNR 111
           V  L  L    +++  R+A     +VK   + FC + V N++N+H +  L+    I  N+
Sbjct: 217 VRELRALGLTPDLLACRSAQPLIGSVKEKLSQFCHVPVENILNIHDVPNLWHVPLILRNQ 276

Query: 110 LGH 102
             H
Sbjct: 277 KVH 279


>11_06_0337 - 22454281-22456399,22458520-22459388
          Length = 995

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +2

Query: 269 IKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDE 367
           +KS V++    L +EY+  I G HD+IQY  DE
Sbjct: 12  VKSLVNKLGSLLAQEYT-LISGVHDDIQYINDE 43


>03_02_0857 + 11839400-11839633,11839665-11839787,11839846-11840259
          Length = 256

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -2

Query: 567 HLVAAVLKSRLQHAYRHVAVLCLSTNWGKQY 475
           H  +A L  RL+HA+ HV  LC    +G+QY
Sbjct: 41  HFPSASLFHRLRHAH-HVLALCTLRQYGQQY 70


>10_08_0639 +
           19505934-19506088,19506584-19506633,19508153-19508893,
           19509762-19509922
          Length = 368

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 1/41 (2%)
 Frame = -2

Query: 624 FVSKRHNNFVTNRVVLKR*-HLVAAVLKSRLQHAYRHVAVL 505
           F+ K  +NF  + V ++R  ++VA ++K +  H YRH+ +L
Sbjct: 160 FMRKARHNFRLDEVGIRRQLNMVARIIKYKDFHLYRHLEML 200


>08_02_1480 +
           27401923-27402158,27402847-27402982,27403119-27403168,
           27403810-27403813,27404394-27404494,27405084-27406305
          Length = 582

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%)
 Frame = -2

Query: 630 VNFVSKRHNNFVTNRVVLKR*-HLVAAVLKSRLQHAYRHVAVL 505
           V F+ K  +NF  + V ++R   +V+ ++K +  H YRH+  L
Sbjct: 422 VGFMRKARHNFRLDEVGIRRQLKIVSQIIKRKDSHLYRHLQKL 464


>06_02_0086 -
           11567390-11567634,11568316-11568341,11571082-11571224,
           11571569-11571682,11571855-11572888,11574723-11575047,
           11576843-11577124
          Length = 722

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 2/69 (2%)
 Frame = +2

Query: 314 YSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKYC--LP 487
           YS  IDG    I Y  D+H  V+ ++     SK   + + HD   K ++ +   +   +P
Sbjct: 517 YSCNIDG----IAYNLDDHILVASKDKESAPSKLQSLWEEHDSRSKMALVSPYFFASDIP 572

Query: 488 QLVDKHNTA 514
           +L+ K  TA
Sbjct: 573 ELISKPCTA 581


>03_01_0612 -
           4501595-4501619,4501752-4501906,4502051-4502092,
           4502238-4502279,4502365-4502464,4502825-4502889,
           4503140-4503217
          Length = 168

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 18/70 (25%), Positives = 37/70 (52%)
 Frame = +2

Query: 266 RIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYT 445
           R+K ++ E   +L +   +++     N++  ++   S+    GSVLK+K  KIL   D  
Sbjct: 35  RLKEELAETSLRLRQMRGEELHRL--NVEQLQELEKSLESGLGSVLKTKSKKILDEIDGL 92

Query: 446 DKKSIETYEK 475
           ++K ++  E+
Sbjct: 93  ERKRMQLIEE 102


>04_03_0627 + 18147789-18148052,18148492-18148955,18149863-18150043
          Length = 302

 Score = 27.9 bits (59), Expect = 9.2
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +2

Query: 389 NGSVLKSKFAKILKSHDYTDKKSIETYEKYCLPQLVDKHNTATWRYAC 532
           NG + K+K  + L +HD T  K I+ Y   C  QL D +      Y C
Sbjct: 257 NGPMKKNK--EDLVNHDATGPKFIQEYAIQCSKQLFDIYRNKEDLYFC 302


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,443,124
Number of Sequences: 37544
Number of extensions: 367565
Number of successful extensions: 922
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 898
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 922
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2016060588
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -