SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120039.Seq
         (672 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0554 + 20351660-20352299,20398588-20398907,20399120-203993...    28   7.8  

>12_02_0554 +
           20351660-20352299,20398588-20398907,20399120-20399344,
           20399375-20399818
          Length = 542

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 17/81 (20%), Positives = 35/81 (43%)
 Frame = +3

Query: 243 KAKAKVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNL 422
           K    VP+  A ++P   +  K +   ++     + +  +   + H +  +  TKQ  N+
Sbjct: 286 KIHINVPLLDAMQVPTHARYLKDILNNKRPLPTTEGRSWLQMNLDHNSTVVKLTKQCSNV 345

Query: 423 TLHQLRNKNHQMTATVMMMLR 485
            LH+L  K   +  T+   +R
Sbjct: 346 ILHKLSEKKDPVCPTISCSIR 366


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,416,334
Number of Sequences: 37544
Number of extensions: 205976
Number of successful extensions: 559
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 546
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 559
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1703141568
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -