SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120038.Seq
         (762 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_02_0235 + 6122145-6122206,6122408-6122417,6123515-6123549,612...    30   1.7  
07_01_0618 + 4577417-4577430,4577838-4577874,4578070-4578173,457...    28   7.1  
06_01_0915 - 7054701-7055809,7056062-7056359                           28   7.1  

>09_02_0235 +
           6122145-6122206,6122408-6122417,6123515-6123549,
           6124422-6124842,6124978-6125412
          Length = 320

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +1

Query: 529 FVRVCRATNCVFST*PTPERIEVVLAIN 612
           FV V ++TNC+    P PE I+ VLAI+
Sbjct: 219 FVPVLQSTNCLMEPLPIPEPIKEVLAIS 246


>07_01_0618 +
           4577417-4577430,4577838-4577874,4578070-4578173,
           4578512-4578707,4579559-4579628,4579849-4579952,
           4580296-4580335,4581016-4581070,4581418-4581426,
           4582026-4582157,4582544-4582613,4583029-4583086,
           4583173-4583228,4583315-4583470,4583589-4583700,
           4583782-4583923,4584141-4584216,4584306-4584401,
           4584509-4584637
          Length = 551

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = -2

Query: 743 QTRFVNYTRGAISKSQFLRVDLQVLGR 663
           Q RF+NY    ++  QFL++  Q+ GR
Sbjct: 313 QKRFINYLVNQLAAHQFLKIACQIEGR 339


>06_01_0915 - 7054701-7055809,7056062-7056359
          Length = 468

 Score = 28.3 bits (60), Expect = 7.1
 Identities = 17/43 (39%), Positives = 20/43 (46%)
 Frame = +3

Query: 588 HRGGVGDQLFNNYSGFLQNLIRRAVAPEYLQIDTEELRFRNSA 716
           H   VGD L  N +  L  L+     PE +  D EE RFR  A
Sbjct: 177 HLAFVGDSLARNQAESLVCLLASRSTPELVHRDGEENRFRRWA 219


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,984,779
Number of Sequences: 37544
Number of extensions: 419261
Number of successful extensions: 949
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 926
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 949
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2039640244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -