SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120035.Seq
         (749 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_05_0080 - 22243175-22243226,22243342-22243389,22243485-222435...    29   3.9  
09_04_0170 + 15310240-15310397,15310523-15310605,15310689-153106...    29   5.2  
12_01_0441 + 3484003-3484374,3485071-3485151,3485242-3485514,348...    28   6.9  
04_04_1551 - 34348110-34348225,34348468-34348606,34348658-343488...    28   6.9  

>05_05_0080 -
           22243175-22243226,22243342-22243389,22243485-22243540,
           22243752-22243819,22244712-22244773,22245166-22245214,
           22245818-22245899,22245987-22246064,22246441-22246499,
           22246727-22246805,22246946-22247218
          Length = 301

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 16/65 (24%), Positives = 30/65 (46%)
 Frame = +3

Query: 63  ASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAASNFLAS 242
           A   S+  P+  ++  G     +  QP+ YLN   +  P+G   +V D   A     +A+
Sbjct: 175 AENASSVLPATKTYHLGLRRDEETLQPSIYLNNLPDKIPEGTRVLVVDPMLATGGTIVAA 234

Query: 243 VNSLL 257
           ++ L+
Sbjct: 235 IDLLV 239


>09_04_0170 +
           15310240-15310397,15310523-15310605,15310689-15310697,
           15310852-15310940,15311514-15311587,15311731-15311781,
           15311887-15311963,15313865-15314463
          Length = 379

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 18/52 (34%), Positives = 26/52 (50%)
 Frame = +3

Query: 33  QTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGA 188
           +TT T     +S  S+P+P +A+ D+G S  C    P D   Y+     DGA
Sbjct: 302 ETTTTSSTTTSS--SSPSPPQATKDDGASPQC--SFPEDIQTYFGCAAEDGA 349


>12_01_0441 +
           3484003-3484374,3485071-3485151,3485242-3485514,
           3485695-3485826,3485903-3486076,3486164-3486393,
           3486562-3486679,3486717-3486743,3486948-3487079,
           3487189-3487323,3487393-3487599,3487772-3487936
          Length = 681

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = +2

Query: 422 NHRQLELNGSWTNTWTIHKVWW 487
           N R   +NGSW   W + K+ W
Sbjct: 361 NRRLAAVNGSWLGAWGLEKLLW 382


>04_04_1551 - 34348110-34348225,34348468-34348606,34348658-34348896,
            34349042-34349140,34349207-34350188,34350737-34350832,
            34350936-34351064,34351253-34351332,34351420-34351661,
            34351743-34352692
          Length = 1023

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 29/108 (26%), Positives = 43/108 (39%), Gaps = 1/108 (0%)
 Frame = +3

Query: 117  SEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAASNFLASVN-SLLMITI*WNVCSRP 293
            SE    Q PN     YN PTP    TV+ +S       +L S   S+  +    N   + 
Sbjct: 905  SESQHSQAPNAVTKGYNAPTP---STVLGNSCHGTTLLYLRSQKASIYRVECTVNRLGQT 961

Query: 294  LIISEKQLVLLIIRNPLSCLLRRTIAQFCL*CGIF*AVCWCEPTIGSW 437
            ++ +   L  LI  +P     RR +  F +  GIF     C  ++  W
Sbjct: 962  MLAAAMSLGQLIPSSPYQLFERRAV-NFVM-AGIFGVRMGCVASVSVW 1007


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,969,849
Number of Sequences: 37544
Number of extensions: 391699
Number of successful extensions: 1049
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1018
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1049
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1992480932
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -