SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120034X.Seq
         (582 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_02_0110 - 5371536-5372882                                           31   0.51 
11_03_0026 - 9057965-9058234,9059410-9059522,9059612-9059802,906...    29   2.7  
11_06_0263 + 21777178-21777342,21777742-21777823,21777939-217780...    29   3.6  
04_01_0083 + 904473-905167,905247-905347,905902-905994,907322-90...    28   4.7  
04_01_0044 + 489486-490012,490903-491332                               28   4.7  
01_03_0010 - 11608537-11608786,11608816-11608940,11609152-116092...    28   4.7  
02_05_1333 - 35761405-35761822,35762551-35763155                       28   6.2  
01_06_1510 - 37859664-37861319                                         28   6.2  
09_04_0719 + 19716536-19716857,19716949-19717101,19717493-197177...    23   9.2  

>10_02_0110 - 5371536-5372882
          Length = 448

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 6/68 (8%)
 Frame = -1

Query: 336 ITPDLVMSTVCGCKY----SG-SPCFATLSGACAGFGRHAQTSICTCRRRGHVLPVHNLH 172
           I+PD  +S +   +Y    +G S C+    G+  G  R  Q S+CT R R H L VH   
Sbjct: 320 ISPDGKLSFIVTSRYFDGSAGVSSCYHLAFGSNGGCTRE-QVSVCTWRVRLHELRVHRSD 378

Query: 171 ILNC-WRC 151
            +N  W C
Sbjct: 379 AMNLRWFC 386


>11_03_0026 -
           9057965-9058234,9059410-9059522,9059612-9059802,
           9060606-9060720,9061781-9061907,9062915-9062990,
           9064247-9064365,9065430-9065593,9065666-9065779,
           9065966-9066065,9066276-9066340,9068175-9068253,
           9069513-9069659,9069904-9070161,9070657-9070852,
           9071179-9071402,9072531-9072554
          Length = 793

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 11/23 (47%), Positives = 17/23 (73%)
 Frame = -3

Query: 334 HARFGNEHCVWVQIQRVALLCHA 266
           H  FG++H + VQ+Q  A++CHA
Sbjct: 203 HIVFGSQHNLPVQLQAKAVICHA 225


>11_06_0263 +
           21777178-21777342,21777742-21777823,21777939-21778028,
           21778447-21778604,21778852-21778873,21779048-21779175,
           21779486-21779685,21780600-21780663,21781594-21781704,
           21781804-21781941,21782306-21782448,21782521-21782575,
           21782921-21782977,21783093-21783176
          Length = 498

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 11/28 (39%), Positives = 13/28 (46%)
 Frame = -3

Query: 310 CVWVQIQRVALLCHAIWSMCWIWSACSN 227
           C+ V I  V   CH  W +C  WS   N
Sbjct: 161 CILVLISSVGQSCHKNWVLCIAWSPDGN 188


>04_01_0083 +
           904473-905167,905247-905347,905902-905994,907322-907968
          Length = 511

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +3

Query: 225 TFEHADQIQHMLQIAWQSRATRCICTHTQCSL 320
           + EH   I+H ++I WQ    R +C    C L
Sbjct: 255 SLEHHQAIRHAVKIGWQKYIKRYLCLAIFCML 286


>04_01_0044 + 489486-490012,490903-491332
          Length = 318

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = -1

Query: 279 CFATLSGACAGFGRHAQTSICTC 211
           C  T  G C G G +  TS C+C
Sbjct: 267 CSPTCKGLCVGCGENLNTSSCSC 289


>01_03_0010 -
           11608537-11608786,11608816-11608940,11609152-11609217,
           11609741-11609872,11610507-11610608,11610743-11610940,
           11611015-11611161,11611321-11611431,11613241-11613780,
           11613847-11614003,11614148-11614297,11614375-11614514,
           11615346-11615468,11615561-11615677,11617184-11617357,
           11617768-11617909,11618076-11618194,11619773-11619955
          Length = 991

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 12/50 (24%), Positives = 24/50 (48%)
 Frame = +3

Query: 150 DIASSLKYVNCERAIRVHVDGKYKSTFEHADQIQHMLQIAWQSRATRCIC 299
           D++S + + +  +    H+D ++  T E  DQ+ ++L I        C C
Sbjct: 565 DVSSVIGHYDTSKQNVHHMDNEWWETQERGDQVDYVLDIGEVGPRATCCC 614


>02_05_1333 - 35761405-35761822,35762551-35763155
          Length = 340

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = -1

Query: 279 CFATLSGACAGFGRHAQTSICTC 211
           C  T  G C G G +  TS C+C
Sbjct: 293 CSPTCKGLCLGCGENLNTSSCSC 315


>01_06_1510 - 37859664-37861319
          Length = 551

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 298 APTHSAHYQIWRDSTDNEVQIALRHRITRMA 390
           AP H  H+Q++R S      +ALRHR  R A
Sbjct: 24  APAHG-HHQVFRCSAAKPSPLALRHRAGRPA 53


>09_04_0719 +
           19716536-19716857,19716949-19717101,19717493-19717707,
           19717785-19717855,19717998-19718157,19718598-19718790,
           19718936-19719091,19719229-19719317,19719602-19719695,
           19719870-19720039
          Length = 540

 Score = 23.0 bits (47), Expect(2) = 9.2
 Identities = 16/60 (26%), Positives = 25/60 (41%)
 Frame = +2

Query: 248 PAHAPDSVAKQGDPLYLHPHTVLITKSGVIQLIMKSKLPYGIELQEWLLEEVIPQVLCTG 427
           P HA  S   +  P     H V++  +G+I L +   L     L   + +  +P   CTG
Sbjct: 47  PLHALRSQRPEPAPASASHHDVVVVGAGIIGLSIARHLLLHTPLSVAVADAAVP---CTG 103



 Score = 22.6 bits (46), Expect(2) = 9.2
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = +2

Query: 233 ACRPNPAHAPDS 268
           A  PNP+HAP S
Sbjct: 7   ASAPNPSHAPSS 18


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,177,841
Number of Sequences: 37544
Number of extensions: 390407
Number of successful extensions: 1090
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1065
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1090
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1364465340
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -