SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120033.Seq
         (717 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_01_0311 - 2075881-2076165,2076450-2076519,2076628-2076691,207...    31   1.2  
12_01_0950 - 9463148-9464358,9465326-9465644                           29   2.8  
07_03_0981 + 23112253-23112538,23112842-23112885                       28   6.4  
01_04_0010 - 15058175-15058195,15058320-15058430,15059031-150592...    28   6.4  
06_01_1036 + 8134132-8134539,8134885-8134956,8134969-8135088,813...    28   8.5  

>02_01_0311 -
           2075881-2076165,2076450-2076519,2076628-2076691,
           2076798-2076837,2076930-2077006,2077095-2077311,
           2077482-2078132
          Length = 467

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 19/69 (27%), Positives = 31/69 (44%)
 Frame = -3

Query: 355 LCSPASSTLLKCSVRIGLINTHSYTSSALRIVFLPRLDRCATSADNTILRARLKTRCLTR 176
           LC   +ST L C+++   I T S +SS+L  +     D    S+ + + +A      L+ 
Sbjct: 41  LCGSTNSTSLSCAIQSSNIKTESISSSSLPKILPFSTDSNGESSLSRMSQAEFSDPILSS 100

Query: 175 SCATCRFRY 149
           S   C   Y
Sbjct: 101 SSTFCTSLY 109


>12_01_0950 - 9463148-9464358,9465326-9465644
          Length = 509

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 3/48 (6%)
 Frame = +3

Query: 135 LFRSR*RKRHVAH---DRVKQRVFKRARKIVLSALVAQRSSRGRKTIL 269
           +F +R   R + H    RVKQ+ FK+ R  +L  L++QR+    + IL
Sbjct: 124 VFGARLATREIKHRRAKRVKQKFFKQNRGHLLEQLISQRADIAERMIL 171


>07_03_0981 + 23112253-23112538,23112842-23112885
          Length = 109

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +3

Query: 204 ARKIVLSALVAQRSSRGRKTILNADDVYECVLIKPIR 314
           A ++       Q  +RGR+  L AD+V   +L+ P+R
Sbjct: 11  AARVPAELCQGQGGARGRRRRLRADEVLRALLVAPVR 47


>01_04_0010 -
           15058175-15058195,15058320-15058430,15059031-15059246,
           15059327-15059505,15059655-15059820,15059914-15059972,
           15060065-15060107,15060285-15060354,15060458-15060547,
           15060621-15060742,15060777-15060808,15060876-15061064,
           15061148-15061241,15061325-15061412,15061498-15061718,
           15061924-15061997,15062081-15062363,15062455-15062589,
           15062721-15062942,15063029-15063208,15063305-15063402,
           15063522-15063634,15064156-15064259,15064400-15064522,
           15064857-15065192
          Length = 1122

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
 Frame = +3

Query: 180 VKQRVFKRA-RKIVLSALVAQRSSRGRKTILNADDVYECV 296
           ++++V +RA +K+ L ALV Q+     +  +N DD+ + V
Sbjct: 662 IEEKVIERAYKKLALDALVIQQGRLAEQKTVNKDDLLQMV 701


>06_01_1036 + 8134132-8134539,8134885-8134956,8134969-8135088,
            8135179-8135256,8135442-8135697,8136427-8136515,
            8137229-8137376,8137460-8137899,8138048-8138562,
            8138791-8139061,8139231-8139492,8139583-8139938
          Length = 1004

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 24/95 (25%), Positives = 36/95 (37%), Gaps = 1/95 (1%)
 Frame = +1

Query: 13   KLDLCASVKLTPFKPMRP-PKPMQCWIHPRRANCKVTRPRNNYSDPDNENDMLHMTVLNS 189
            KL L A  +L     + P P P      P R   + +   ++ SD D + D LH T ++ 
Sbjct: 888  KLGLDAGFRLETNSVVPPTPAPRSVRPPPSRRRARRSPSSSDDSDIDGQEDNLHATSVSR 947

Query: 190  VFLNEHAKLYYRHLLRNDQAEAEKQFSTPTTCTSA 294
            V          R    +  A   K  + PT   S+
Sbjct: 948  VAATPVVMTAARSQRASKTAAMSKMSAKPTVAASS 982


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,528,139
Number of Sequences: 37544
Number of extensions: 313613
Number of successful extensions: 872
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 855
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 872
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1862792824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -