SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_0539 + 3952039-3952219,3952295-3952984,3953115-3953191,395...    35   0.057
02_05_0633 - 30492742-30492987,30493082-30494194                       29   2.8  
02_02_0066 - 6501250-6501273,6502018-6502102,6502926-6503110           29   2.8  
04_01_0213 - 2692253-2694562                                           28   6.6  
02_02_0319 - 8917042-8917122,8917628-8917680,8917754-8917800,891...    28   6.6  

>01_01_0539 +
           3952039-3952219,3952295-3952984,3953115-3953191,
           3953356-3953931
          Length = 507

 Score = 35.1 bits (77), Expect = 0.057
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 3/50 (6%)
 Frame = +1

Query: 388 PRHGLATVSHRIYGQNHRTQ---FAFVPAQEFYLHVYHHMGHHDFLSLII 528
           P +        IYG +  TQ    A V AQE+Y H +HH+ HH   + ++
Sbjct: 349 PEYATQAAGPAIYGAHPATQPHYTAAVAAQEYYHHHHHHLQHHPAAAALV 398


>02_05_0633 - 30492742-30492987,30493082-30494194
          Length = 452

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = -1

Query: 204 CNEKKAASAVSWRLAKRSCCICVRRRPQRRC 112
           C+ +KAA AV  + A R+C  C+RRR +  C
Sbjct: 3   CSSEKAAGAVGGKAA-RACDSCLRRRARWYC 32


>02_02_0066 - 6501250-6501273,6502018-6502102,6502926-6503110
          Length = 97

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 25/85 (29%), Positives = 35/85 (41%)
 Frame = +2

Query: 116 RRCGRRLTQIQHDRFASRHDTADAAFFSLQRQLFVVFVSSHRPFASSKSAHLTKLLSSQA 295
           R C RR +     R+AS H  A+ A  +  R L     SSHR       A    L+S+  
Sbjct: 12  RSC-RRYSTCYGSRYASHHLPANRALAAAVRLLSSQITSSHRRSQPPPPASRWSLISTFL 70

Query: 296 TYLYHFACLMKYKDIQKYEVQQLIE 370
             L   A L     IQ+ E   +++
Sbjct: 71  CLLKWIAPLEAPHQIQRIEQVDIVD 95


>04_01_0213 - 2692253-2694562
          Length = 769

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/48 (31%), Positives = 27/48 (56%)
 Frame = +1

Query: 478 LHVYHHMGHHDFLSLIIDDMVYTRDKSSLDFVMQQLKTMKVLFYNVFF 621
           L ++H  G  +  S  ++D + +  +  + F MQ L T+ +L+ NVFF
Sbjct: 90  LLMFHAGGPDNITSYSLEDNILSW-RDMIGFFMQVLGTIYILYKNVFF 136


>02_02_0319 -
           8917042-8917122,8917628-8917680,8917754-8917800,
           8917901-8917992,8919725-8920060,8920370-8920423,
           8920547-8920879,8921133-8921207,8921293-8921441,
           8922411-8922429
          Length = 412

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 11/35 (31%), Positives = 20/35 (57%)
 Frame = +2

Query: 443 LNLRSCQPKSFTYTFTTIWDTMTFSVSSSTIWCIR 547
           LN+    P +F Y FT   +T+TF +  + + C++
Sbjct: 107 LNMFLESPSTFAYRFTITSETLTFMIRYNALRCMK 141


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,127,619
Number of Sequences: 37544
Number of extensions: 393356
Number of successful extensions: 1035
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1010
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1034
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1898162308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -