SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0735 - 22636835-22639502,22639755-22640734                       31   0.92 
04_03_0686 + 18701543-18701917,18702658-18702702,18703175-187032...    30   1.6  
01_06_0124 - 26692731-26697046,26698749-26698827,26698899-266989...    30   2.1  
10_08_0961 + 21869612-21869773,21869869-21869956,21870047-218702...    29   3.7  
01_06_1034 + 33962813-33963802                                         29   3.7  
03_05_0866 - 28370034-28371352,28371447-28371995,28372507-28373512     29   4.9  
02_01_0731 - 5471795-5471811,5471953-5472035,5472235-5472331,547...    28   6.5  

>12_02_0735 - 22636835-22639502,22639755-22640734
          Length = 1215

 Score = 31.1 bits (67), Expect = 0.92
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = -2

Query: 408  EQCAQRVEIAFGFLLVKNNFV*MVNLIAVPIAIKYVVVRNFKTFAKIYYIVDFAFVSLCT 229
            E  A+  E+ + +L+V    + MVN +A+ +A    +   F  ++K+     F+F  LC 
Sbjct: 1101 EAFAELYEVRWSYLMVPPVTIMMVNAVAIAVAAARTLYSEFPQWSKLLGGAFFSFWVLC- 1159

Query: 228  YLY 220
            +LY
Sbjct: 1160 HLY 1162


>04_03_0686 +
           18701543-18701917,18702658-18702702,18703175-18703289,
           18703644-18703713,18703796-18703844,18704319-18704416,
           18704984-18705122,18705261-18705410
          Length = 346

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +1

Query: 208 AQFQVQIRAQRHERKIYNVIDFCKGLE-IAHDDILDCNWD 324
           + F V         + YNV   C  +E IAHD +LDC+WD
Sbjct: 293 SDFIVDAEGLSETARFYNVQPVC--IEGIAHDMMLDCSWD 330


>01_06_0124 -
           26692731-26697046,26698749-26698827,26698899-26698955,
           26699321-26699416
          Length = 1515

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/70 (25%), Positives = 35/70 (50%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           L DKI  + K    L +  ++   + +   ND+  +FEQ  + + + + +L +  S  + 
Sbjct: 717 LNDKIAVLQKEGSSLASELQQLEASFKNLGNDLEQKFEQISV-MQKNNEELELANSNLQN 775

Query: 687 KTAIVTESKN 716
           + A+V E KN
Sbjct: 776 ELAMVQEQKN 785


>10_08_0961 +
           21869612-21869773,21869869-21869956,21870047-21870277,
           21870371-21870538,21870808-21871001,21871151-21871234,
           21871315-21871434,21871621-21871714,21871813-21871973,
           21873237-21873313,21873738-21873932,21874487-21874559,
           21874635-21874721,21874906-21875043,21875181-21875383,
           21875469-21875631,21875861-21875992
          Length = 789

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 15/71 (21%), Positives = 35/71 (49%)
 Frame = +3

Query: 507 LRDKIESVLKHVKKLNTNSEKFMVTHETFKNDVGNRFEQFELRLNELDAKLNMLQSAEKL 686
           L++ ++++ + V  +N   EK++   E FKN+      + +    EL+  +  L+ + + 
Sbjct: 173 LKEVVDNLRQAVSIINRKHEKYLDEIEAFKNNQSRELHEVKCLSGELEESMAELEESRR- 231

Query: 687 KTAIVTESKNG 719
           K A++     G
Sbjct: 232 KLAVLQLQTGG 242


>01_06_1034 + 33962813-33963802
          Length = 329

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = -1

Query: 376 WISACEK*FRLNGKLDRCPNCN 311
           W  AC +  R++G+   CPNCN
Sbjct: 8   WCYACRRPIRVSGQDITCPNCN 29


>03_05_0866 - 28370034-28371352,28371447-28371995,28372507-28373512
          Length = 957

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 13/42 (30%), Positives = 23/42 (54%)
 Frame = +1

Query: 319 WDSDQVYHLNEIIFHKQKSKRDLNSLGALFATKQGLLKILMR 444
           +D D +  LNE++  ++K K+DL     L+  K  L ++  R
Sbjct: 660 YDQDALERLNELVVKREKEKQDLERELELYRRKVHLFEVKER 701


>02_01_0731 -
           5471795-5471811,5471953-5472035,5472235-5472331,
           5472460-5472652,5472782-5472849,5473345-5473639
          Length = 250

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = -3

Query: 683 FFGRLQHVKFGVEFVQTQFKLLKPVAHIVLER 588
           FFG L H+K  +E     FKLL    ++ LER
Sbjct: 27  FFGSLSHLKNDLECYLISFKLLPKYRNLHLER 58


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,667,524
Number of Sequences: 37544
Number of extensions: 283453
Number of successful extensions: 734
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 718
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 734
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1874582652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -