SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120027.Seq
         (774 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_03_0003 + 11396076-11396386,11398803-11398869,11399194-113996...    30   2.3  
05_06_0262 - 26746180-26746278,26746371-26746493,26746584-267467...    29   3.1  
05_05_0080 - 22243175-22243226,22243342-22243389,22243485-222435...    29   3.1  
01_06_1486 - 37709159-37709377,37709558-37709821,37709903-377099...    29   3.1  
01_06_0412 + 29159918-29160046,29160148-29160297,29160385-291604...    29   3.1  
08_02_1499 - 27558872-27559015,27559544-27559666,27560214-275603...    29   4.1  
08_02_1054 + 23980962-23981096,23981208-23981420,23983062-239831...    29   4.1  
09_04_0170 + 15310240-15310397,15310523-15310605,15310689-153106...    29   5.4  
02_02_0220 - 7992124-7992351,7992458-7992562,7993499-7993711,799...    29   5.4  
01_01_1145 + 9073973-9074281,9075440-9075998,9076088-9076241,907...    29   5.4  
12_01_0441 + 3484003-3484374,3485071-3485151,3485242-3485514,348...    28   7.2  

>09_03_0003 +
           11396076-11396386,11398803-11398869,11399194-11399698,
           11400903-11401038,11401186-11401257,11401891-11401923,
           11401924-11402047,11402387-11402437,11403437-11403563,
           11404230-11404298,11404369-11404486,11404755-11405151
          Length = 669

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 4/91 (4%)
 Frame = +3

Query: 261 VNNQTTMTQINFNASY-TSAPTPSRAS---FDNGYSEFCDKQQPNDYLNYYNNPTPDGAD 428
           V +  T   +NF+ +  TS PT         D  Y+EF  K Q  ++  YYN       +
Sbjct: 174 VTSPATSIPLNFSWTIPTSWPTIEAVPAYYVDVHYTEF-QKPQGREFNTYYNGALWPANE 232

Query: 429 TVVSDSETAAASNFLASVNSLTDDNDIWNVC 521
             ++     A   F  S +  T DN  +N+C
Sbjct: 233 NPITPPYLLADYTF--STSQYTSDNGFYNIC 261


>05_06_0262 -
           26746180-26746278,26746371-26746493,26746584-26746725,
           26746824-26746921,26747012-26747108,26747215-26747322,
           26747900-26748003,26748170-26748268,26748373-26748435,
           26748538-26748687,26748769-26748900
          Length = 404

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = -3

Query: 274 VWLFTIVRRQCQLAKKCRAHHKDIDIFKHLCPELQ 170
           V+L T  R+ C  A      H+ +D+FKH   EL+
Sbjct: 70  VFLLTASRQNCNAASILLFLHRVVDVFKHYFEELE 104


>05_05_0080 -
           22243175-22243226,22243342-22243389,22243485-22243540,
           22243752-22243819,22244712-22244773,22245166-22245214,
           22245818-22245899,22245987-22246064,22246441-22246499,
           22246727-22246805,22246946-22247218
          Length = 301

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 16/66 (24%), Positives = 30/66 (45%)
 Frame = +3

Query: 300 ASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTVVSDSETAAASNFLAS 479
           A   S+  P+  ++  G     +  QP+ YLN   +  P+G   +V D   A     +A+
Sbjct: 175 AENASSVLPATKTYHLGLRRDEETLQPSIYLNNLPDKIPEGTRVLVVDPMLATGGTIVAA 234

Query: 480 VNSLTD 497
           ++ L +
Sbjct: 235 IDLLVE 240


>01_06_1486 -
           37709159-37709377,37709558-37709821,37709903-37709995,
           37710387-37710581,37710665-37710763,37710884-37711132,
           37711264-37711467,37711543-37711602,37711731-37711913,
           37712382-37712999,37713101-37713169,37713275-37713853
          Length = 943

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 16/59 (27%), Positives = 28/59 (47%)
 Frame = +3

Query: 375 QPNDYLNYYNNPTPDGADTVVSDSETAAASNFLASVNSLTDDNDIWNVCSRPLIISEKQ 551
           +P    +    PT   A    S S T AA    ASV+   ++  + +V  RP+++ E++
Sbjct: 113 RPRPPRSQQQTPTTTAAAAADSRSPTPAAPPQTASVSQREEEKSLASVVKRPMLLDERR 171


>01_06_0412 +
           29159918-29160046,29160148-29160297,29160385-29160447,
           29160540-29160716,29160796-29160899,29162142-29162249,
           29162336-29162432,29162540-29162637,29162718-29162859,
           29162941-29163063,29163161-29163259
          Length = 429

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = -3

Query: 274 VWLFTIVRRQCQLAKKCRAHHKDIDIFKHLCPELQ 170
           V+L T  R+ C  A      H+ +D+FKH   EL+
Sbjct: 69  VFLLTASRQNCNAASILLFLHRVVDVFKHYFEELE 103


>08_02_1499 -
           27558872-27559015,27559544-27559666,27560214-27560312,
           27561257-27561307
          Length = 138

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = -3

Query: 541 EIISGLEQTFHISLSSVNELTLAKKFEAAAV 449
           EI+ GLE+ FHIS+   +  ++A   +AAA+
Sbjct: 93  EIVMGLEEEFHISVEESSAQSIATVEDAAAL 123


>08_02_1054 +
          23980962-23981096,23981208-23981420,23983062-23983157,
          23983420-23983565,23983679-23983898,23984502-23984561
          Length = 289

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 59 WPSPSRIRDLIHKTFAL 9
          WP+P R+RDLI +T +L
Sbjct: 45 WPAPDRVRDLIRRTRSL 61


>09_04_0170 +
           15310240-15310397,15310523-15310605,15310689-15310697,
           15310852-15310940,15311514-15311587,15311731-15311781,
           15311887-15311963,15313865-15314463
          Length = 379

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 18/52 (34%), Positives = 26/52 (50%)
 Frame = +3

Query: 270 QTTMTQINFNASYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGA 425
           +TT T     +S  S+P+P +A+ D+G S  C    P D   Y+     DGA
Sbjct: 302 ETTTTSSTTTSS--SSPSPPQATKDDGASPQC--SFPEDIQTYFGCAAEDGA 349


>02_02_0220 -
           7992124-7992351,7992458-7992562,7993499-7993711,
           7993937-7994196,7994425-7994701,7995226-7995371,
           7995519-7995903,7996680-7996964
          Length = 632

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 12/30 (40%), Positives = 15/30 (50%)
 Frame = +2

Query: 14  QMFCESNHEFDLDSASCKPIVYDRTGSGCA 103
           QM+     E +  S  C+   Y RTG GCA
Sbjct: 4   QMWMRKEAEDERTSGGCEETAYARTGGGCA 33


>01_01_1145 +
           9073973-9074281,9075440-9075998,9076088-9076241,
           9077475-9077565,9077722-9077793,9077879-9078390,
           9078854-9078923,9079514-9079579,9080266-9080570,
           9080872-9081006,9081141-9081204,9081429-9081574,
           9081669-9081773,9082310-9082490
          Length = 922

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 1/81 (1%)
 Frame = +3

Query: 303 SYTSAPTPSRASFDNGYSEFCDKQQPNDYLNYYNNPTPDGADTV-VSDSETAAASNFLAS 479
           S TS P+PS  S DN   E C+K   + Y      P P   D V +  S+  +     +S
Sbjct: 412 SGTSLPSPSSTSMDNTTGE-CNK---DAYSEDEKKPHPRSVDCVGMGASDEPSHDTLSSS 467

Query: 480 VNSLTDDNDIWNVCSRPLIIS 542
           V SL       ++ ++P  IS
Sbjct: 468 VTSLNKGLSNISIDNKPKSIS 488


>12_01_0441 +
           3484003-3484374,3485071-3485151,3485242-3485514,
           3485695-3485826,3485903-3486076,3486164-3486393,
           3486562-3486679,3486717-3486743,3486948-3487079,
           3487189-3487323,3487393-3487599,3487772-3487936
          Length = 681

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = +2

Query: 659 NHRQLELNGSWTNTWTIHKVWW 724
           N R   +NGSW   W + K+ W
Sbjct: 361 NRRLAAVNGSWLGAWGLEKLLW 382


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,640,108
Number of Sequences: 37544
Number of extensions: 425028
Number of successful extensions: 1171
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1141
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1171
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2068401984
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -