SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_1415 + 37171380-37171923,37172476-37172666,37173628-37173678     29   3.8  
03_05_0092 - 20714102-20717902                                         29   5.0  
04_01_0203 + 2432745-2433642,2433723-2433806,2434458-2434471           28   6.6  
07_03_0508 - 18892193-18893119,18893183-18894528,18894594-18895206     28   8.7  

>01_06_1415 + 37171380-37171923,37172476-37172666,37173628-37173678
          Length = 261

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +3

Query: 348 KKKVINNNKYILFNSWYTKIKQPEWPSSPAMWDLVKNTPELADFV 482
           +   I+ N Y+   +W T+  QP    S   W L K +   A +V
Sbjct: 133 RSSTISENSYLCVATWDTRAPQPSQIESAVRWALRKRSQNKAVYV 177


>03_05_0092 - 20714102-20717902
          Length = 1266

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -2

Query: 455 FHQIPHGRATRPLGLLDLSVPTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLFF 276
           F  +       PL +  L++ T   N+  ++N L L   H +    D+H+++ I  ++FF
Sbjct: 571 FFMVTESSGDVPLEVRHLTIMT--NNLSKLINDLSLKISHSSG--SDQHFLQRIRTIIFF 626

Query: 275 QEIYNSNSW 249
            +  NS+ +
Sbjct: 627 ADFSNSDEF 635


>04_01_0203 + 2432745-2433642,2433723-2433806,2434458-2434471
          Length = 331

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
 Frame = +3

Query: 396 YTKIKQPEWPSSPAMWDLVKNTPELADFVFI-FDHTEK 506
           + +  +PEWPSS A+     N PEL   V +  D T K
Sbjct: 169 HDQTNKPEWPSSVAVQHDQTNKPELPSSVAVQHDQTNK 206


>07_03_0508 - 18892193-18893119,18893183-18894528,18894594-18895206
          Length = 961

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 13/43 (30%), Positives = 20/43 (46%)
 Frame = +3

Query: 36  RCVFITNELPGCWALKKYIIKNTSGSFQRFTKIKHGKHAGATI 164
           +  FIT     C+    + +KN   +FQR T+I  G   G  +
Sbjct: 803 KTAFITRIGTYCYTTMPFGLKNAGPTFQRTTRISLGSQIGRNV 845


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,418,829
Number of Sequences: 37544
Number of extensions: 410959
Number of successful extensions: 1046
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1009
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1046
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1909952136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -