SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_07_0130 + 41262652-41262798,41262958-41263056,41263155-412632...    80   2e-15
01_07_0129 + 41243686-41243853,41243936-41244053,41245485-412455...    75   8e-14
12_02_1237 + 27245411-27245842                                         32   0.58 
09_06_0311 + 22218219-22218421,22219157-22219422,22219881-222200...    32   0.58 
04_01_0468 + 6032467-6033670,6033858-6033964,6034122-6034178           31   1.3  
05_02_0134 + 6954760-6955434                                           30   2.4  
09_02_0229 - 6062825-6064899,6064943-6065432,6065479-6065956,606...    29   4.1  
02_05_0388 + 28541751-28541820,28541912-28542054,28542199-285422...    28   7.2  
02_01_0314 + 2106976-2107658,2107792-2107931,2108367-2108636,210...    28   9.5  

>01_07_0130 +
           41262652-41262798,41262958-41263056,41263155-41263220,
           41264073-41264255
          Length = 164

 Score = 79.8 bits (188), Expect = 2e-15
 Identities = 37/68 (54%), Positives = 46/68 (67%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           AL   L+N  +YKSVSAF+ + NP  CPWG KAFS YLG  KS W E+DAT L+KK N  
Sbjct: 37  ALTIYLKNTDKYKSVSAFSPVVNPINCPWGQKAFSNYLGPAKSDWKEYDATCLIKKCNKI 96

Query: 741 PLTLLLDR 764
              +L+D+
Sbjct: 97  STPILIDQ 104


>01_07_0129 +
           41243686-41243853,41243936-41244053,41245485-41245532,
           41245756-41245787
          Length = 121

 Score = 74.5 bits (175), Expect = 8e-14
 Identities = 29/47 (61%), Positives = 39/47 (82%)
 Frame = +1

Query: 256 TCSEQNFITKSGFQRYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGV 396
           TC+++NF+TK+G QR AA HG+ +V PDTSPRG+ I+G+  SWDFGV
Sbjct: 65  TCNDENFVTKAGAQRAAAAHGIALVAPDTSPRGLNIEGEADSWDFGV 111



 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 23/54 (42%), Positives = 33/54 (61%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           +L+  S  K+FGG+   + H S+ L C M FS++LPP        LP+LY+LSG
Sbjct: 13  ALEQMSRTKMFGGHNLRFRHHSATLGCPMTFSVFLPPSPAS---DLPVLYWLSG 63


>12_02_1237 + 27245411-27245842
          Length = 143

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 10/22 (45%), Positives = 17/22 (77%)
 Frame = +1

Query: 379 SWDFGVSAGFYLDATNEPWNNN 444
           ++DFG+ AGF++  TN P+N +
Sbjct: 42  AYDFGIPAGFFVPGTNNPYNGD 63


>09_06_0311 + 22218219-22218421,22219157-22219422,22219881-22220050,
            22220149-22220365,22220798-22221021,22221559-22221738,
            22221875-22222013,22222107-22222255,22223394-22223505,
            22223998-22224506,22224661-22224784,22224904-22225178,
            22225507-22225626,22225707-22225769,22225861-22226052,
            22226381-22226440,22226535-22226738,22226926-22227051,
            22227093-22227254,22227357-22227476,22227665-22227820,
            22227895-22227957,22228041-22228168,22228524-22228920,
            22229442-22229544,22229646-22229776,22230096-22230167,
            22230472-22230553,22231083-22231190,22231288-22231429,
            22231659-22231698,22231746-22231876,22232215-22232301,
            22232395-22232605,22232687-22232741,22232836-22232927,
            22233011-22233071,22233361-22233719
          Length = 2010

 Score = 31.9 bits (69), Expect = 0.58
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +1

Query: 379  SWDFGVSAGFYLDATNEPWNNNYRMGSYLN 468
            SW +G+  G Y +  N PW +N    +++N
Sbjct: 1287 SWQYGLDQGLYSEGKNYPWFSNGSSNAFIN 1316


>04_01_0468 + 6032467-6033670,6033858-6033964,6034122-6034178
          Length = 455

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 654 KAFSGYLGEDKSKWAEWDATELVKKYNGPPLTLLL 758
           K F  ++     KW+E+D+   +K  NG P+ LLL
Sbjct: 180 KRFDSFMLSHGFKWSEFDSCVYIKFVNGSPIYLLL 214


>05_02_0134 + 6954760-6955434
          Length = 224

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%)
 Frame = +2

Query: 536 GTQH-GRAWCFSFYSEESWPVQVSKR 610
           G QH G+AWC  F S+  WP   S R
Sbjct: 199 GNQHWGKAWCPQFASQFGWPSLTSGR 224


>09_02_0229 - 6062825-6064899,6064943-6065432,6065479-6065956,
            6066333-6066382,6068917-6069172,6069358-6069503
          Length = 1164

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +2

Query: 242  YLSGQLVVNKTSSLNLVSRGMQPNMV*LS*VLILRHVE----LRLMEM 373
            YL  QLV+ K+S + ++S     N + ++ V  L+H+E    LR ME+
Sbjct: 1036 YLHNQLVIEKSSGVEIISNLPALNKLVITDVHALKHIEHLPSLRYMEL 1083


>02_05_0388 +
           28541751-28541820,28541912-28542054,28542199-28542248,
           28543087-28543210,28543765-28543770
          Length = 130

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = -1

Query: 131 NHQKFYWTILIASCPCLISDELRKNYIHNYLV 36
           NHQ+ +W  L +SC C  S  L +     Y+V
Sbjct: 75  NHQRPWWIALPSSCWCFFSKTLAEREAFYYVV 106


>02_01_0314 +
           2106976-2107658,2107792-2107931,2108367-2108636,
           2109938-2110254
          Length = 469

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 11/21 (52%), Positives = 12/21 (57%)
 Frame = +1

Query: 376 SSWDFGVSAGFYLDATNEPWN 438
           SSWD  V  GF   AT  PW+
Sbjct: 297 SSWDNPVPGGFKFTATKAPWS 317


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,939,175
Number of Sequences: 37544
Number of extensions: 465266
Number of successful extensions: 1005
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 979
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1005
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2075009728
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -