SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120021.Seq
         (683 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_04_0110 - 17357323-17357403,17357487-17357595,17357737-173579...    29   2.6  
02_01_0618 - 4629776-4630037,4630188-4630330,4631200-4631254,463...    28   6.0  
06_03_0099 + 16633928-16638213,16638299-16638386,16638823-166389...    28   7.9  

>03_04_0110 -
           17357323-17357403,17357487-17357595,17357737-17357906,
           17358503-17358649,17358767-17358925,17359410-17359469,
           17359659-17359705,17359786-17359888,17362640-17363080
          Length = 438

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = -1

Query: 518 RGGVLCSVDRPSIVKMLSREFDTEALVNF 432
           +GGV+ S D+  +V  L +EF  E L+N+
Sbjct: 206 KGGVMISFDKIEVVNRLHKEFVHETLLNY 234


>02_01_0618 -
           4629776-4630037,4630188-4630330,4631200-4631254,
           4631539-4631603,4631714-4631857,4632141-4632194,
           4632363-4632410,4632466-4632541,4632624-4632722,
           4633000-4633097,4633615-4633719,4633816-4633924,
           4634137-4634252,4634332-4634496
          Length = 512

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 22/83 (26%), Positives = 31/83 (37%)
 Frame = -1

Query: 512 GVLCSVDRPSIVKMLSREFDTEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNKQP 333
           GVL   D  S        F+     + E + C VR  +    ++      S    S +QP
Sbjct: 103 GVLIKFDTQSFTDSFYMSFNGNRFSSLEGNVCRVRFVEDVHYTQLIEHAHSSVTSSAEQP 162

Query: 332 DYDMDLSDFSITEVEATQYLTLL 264
               DL+   I E    QY T+L
Sbjct: 163 TCPNDLT--KILEAFLQQYATIL 183


>06_03_0099 +
           16633928-16638213,16638299-16638386,16638823-16638950,
           16640008-16640278
          Length = 1590

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -1

Query: 452 TEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVE 288
           TE   N  + + N  I+K      +K+TTR DD  +  Q    M+LS+   T  E
Sbjct: 525 TEDDANLASSSKNTMISKHHNTVDQKSTTRKDDSRNRSQK--IMELSEVRGTNTE 577


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,930,761
Number of Sequences: 37544
Number of extensions: 272919
Number of successful extensions: 634
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 614
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 634
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1733104716
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -