SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120020.Seq
         (726 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_0839 - 6540971-6541978,6542076-6542240,6542330-6542419,654...    31   0.93 
01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237,448...    29   2.8  
11_08_0035 - 27838495-27838655,27838750-27838897,27838987-278391...    29   3.8  
11_08_0021 + 27716298-27716478,27717137-27717309,27717408-277175...    29   3.8  
11_01_0787 + 6578158-6579287,6579439-6580870,6581087-6581097,658...    28   6.6  
01_01_0841 - 6564029-6564348,6564654-6564686,6564793-6565450,656...    28   8.7  

>01_01_0839 -
           6540971-6541978,6542076-6542240,6542330-6542419,
           6542536-6542736,6542886-6543098,6543216-6543461
          Length = 640

 Score = 31.1 bits (67), Expect = 0.93
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = +3

Query: 258 IPPGHVMCPPREITKKVFHYAKWVRNPNKYKRYSELIARQSEAGG 392
           +PP      P EIT+ +   A W ++   Y+RY+  ++ +S AGG
Sbjct: 532 LPPLAAAASPVEITQ-LNATASWKKDGRTYRRYAATVSNRSPAGG 575


>01_01_0602 -
           4484972-4485450,4485949-4485997,4486108-4486237,
           4486636-4486778,4486819-4486877,4487167-4487200,
           4487489-4487629,4487719-4487907,4488027-4488122,
           4488163-4488225,4488588-4489097
          Length = 630

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = +3

Query: 261 PPGHVMCPPREITKKVFHYAKWVRNPNKYK 350
           P   V+CP RE+T++VF  AK + +  +++
Sbjct: 209 PRAVVLCPTRELTEQVFRVAKSISHHARFR 238


>11_08_0035 -
           27838495-27838655,27838750-27838897,27838987-27839192,
           27839291-27839972,27840074-27840247,27840963-27841181,
           27841281-27841400,27841540-27841680,27841762-27841801,
           27841969-27842129,27842506-27842589,27842659-27842721,
           27842808-27842885,27842980-27842984,27843228-27843313,
           27843354-27843544,27844089-27844166,27844255-27844365,
           27844757-27844927,27845026-27845198,27845748-27845928
          Length = 1090

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = -3

Query: 481 IKFSQSNKCN*DASRACSWLFTFSRKLADAPPASDWRAINSLYRL 347
           +K   S   N   S   SW+ +F  +  +A P++ WRA + ++ L
Sbjct: 777 LKILPSRSENSSQSSVISWVSSFITRAIEAYPSATWRACSCMHTL 821


>11_08_0021 +
           27716298-27716478,27717137-27717309,27717408-27717578,
           27717967-27718077,27718168-27718245,27718642-27718832,
           27718873-27718958,27719202-27719206,27719301-27719378,
           27719465-27719527,27719597-27719680,27720049-27720209,
           27720377-27720416,27720774-27720893,27720993-27721211,
           27721927-27722100,27722202-27722883,27722986-27723185,
           27723269-27723407,27723502-27723677
          Length = 1043

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = -3

Query: 481 IKFSQSNKCN*DASRACSWLFTFSRKLADAPPASDWRAINSLYRL 347
           +K   S   N   S   SW+ +F  +  +A P++ WRA + ++ L
Sbjct: 730 LKILPSRSENSSQSSVISWVSSFITRAIEAYPSATWRACSCMHTL 774


>11_01_0787 +
           6578158-6579287,6579439-6580870,6581087-6581097,
           6581525-6582125,6583981-6585054,6585745-6585873,
           6585925-6585963
          Length = 1471

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 3/79 (3%)
 Frame = +1

Query: 22  PWNLITANS-FIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFNVIAENTSISIIVRN 198
           P  +++  S F+ S D     + + R ++    VL+   K+NN   V+AE   + +I RN
Sbjct: 367 PLAIVSIGSLFLFSEDYPISRESLVRLWIAEGFVLS---KENNTPEVVAEGNLMELIYRN 423

Query: 199 LGNCPNNKD--RVKCCDLN 249
           +     N +  RV  C ++
Sbjct: 424 MLQIKENDELGRVTTCTMH 442


>01_01_0841 -
           6564029-6564348,6564654-6564686,6564793-6565450,
           6565530-6565694,6565789-6565878,6565982-6566182,
           6566525-6566737,6566835-6567077
          Length = 640

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 14/41 (34%), Positives = 21/41 (51%)
 Frame = +3

Query: 270 HVMCPPREITKKVFHYAKWVRNPNKYKRYSELIARQSEAGG 392
           H    P EI +K    A W ++   Y RY+  ++ +S AGG
Sbjct: 538 HQHASPVEIEQKAT--ASWEKDGRTYHRYAVTVSNRSPAGG 576


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,397,892
Number of Sequences: 37544
Number of extensions: 339132
Number of successful extensions: 833
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 809
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 833
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1898162308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -