SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120019.Seq
         (804 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_03_0075 - 12218501-12218611,12219028-12219267,12219698-122198...    38   0.012
06_01_0770 - 5756200-5756741,5756790-5757286,5757356-5757782,575...    31   1.1  
04_03_0632 + 18200844-18200970,18201134-18201190,18201370-182014...    31   1.4  
04_04_0969 - 29787617-29787919,29788019-29788180,29788962-297890...    29   4.3  
10_06_0099 - 10677024-10677073,10677894-10677998,10678254-106783...    29   5.7  
11_01_0607 - 4837257-4837447,4837526-4837631,4837913-4838005,483...    28   7.6  
05_04_0366 - 20663243-20663388,20663467-20663572,20664275-206643...    28   10.0 
02_01_0498 - 3614621-3614674,3614780-3617161                           28   10.0 
01_06_1567 + 38293612-38293795,38294467-38294523,38294609-382946...    28   10.0 

>01_03_0075 -
           12218501-12218611,12219028-12219267,12219698-12219815,
           12219949-12220016,12220124-12220375,12221362-12221463,
           12221734-12221802,12221892-12221987,12222161-12222208,
           12222352-12222479,12222818-12222896,12223651-12223797,
           12223956-12224022,12224655-12224830,12225588-12225755,
           12225879-12225992,12226657-12226722,12227306-12227524,
           12228142-12228321,12228481-12228584,12228998-12229277,
           12230582-12231004
          Length = 1084

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 25/79 (31%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = +3

Query: 285 VCEYCEAEIKNWSEDECIEY-AHVTLSPYCAYANKIAEHESFGDNITINAVLVKEGRPKC 461
           V E  E  +K W E    E  A   LS  C     I   E FGD +   AV+  +G   C
Sbjct: 617 VKESVEVAVKAWGEKSLTELEAEERLSYSCEKGRSILIVE-FGDILPKVAVIANKGLTNC 675

Query: 462 VYRCMSNLQSRMDTFVIFG 518
           +  C+S  +  +D  +I G
Sbjct: 676 IIGCLSTQEQWLDACIIVG 694


>06_01_0770 -
           5756200-5756741,5756790-5757286,5757356-5757782,
           5757854-5757911
          Length = 507

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +1

Query: 103 DTPPFYFINTRDNFRDNIAEHVFDMLLERHG 195
           D  P  F+NT D+F   I +H+ + + E+HG
Sbjct: 318 DQCPASFLNTSDDFTARIVDHMVEHIKEQHG 348


>04_03_0632 +
           18200844-18200970,18201134-18201190,18201370-18201460,
           18201545-18201705,18202176-18202303,18202386-18202523,
           18202966-18203058,18203546-18203704
          Length = 317

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = -2

Query: 341 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 255
           FNT V  P++Y  FTIL   +I ++I++K
Sbjct: 239 FNTAVVSPVYYVMFTIL--TIIANMIMYK 265


>04_04_0969 -
           29787617-29787919,29788019-29788180,29788962-29789093,
           29789708-29789760,29790518-29791007
          Length = 379

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 11/44 (25%), Positives = 25/44 (56%)
 Frame = -3

Query: 457 LGLPSFTSTALMVMLSPNDSCSAILLAYAQYGDKVTCAYSIHSS 326
           LG    + T  ++ + PN+  ++ ++A++Q G + TC  S + +
Sbjct: 163 LGSSGTSFTPHIITVKPNEDVASKIMAFSQQGPRTTCIISANGA 206


>10_06_0099 -
           10677024-10677073,10677894-10677998,10678254-10678315,
           10678694-10679197,10679695-10680356,10680695-10680793,
           10680881-10681110,10681227-10681278,10681391-10681577,
           10681661-10681873,10682006-10682175,10683455-10683730,
           10684188-10684643,10685527-10685766,10687517-10687771
          Length = 1186

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 15/52 (28%), Positives = 25/52 (48%)
 Frame = -2

Query: 287 HNVIVDLIVFKPLTIKLLINAVFTMG*FSNEPCLSSNMSNTCSAMLSRKLSR 132
           H +I  L     + + L++  +F  G  +NE C    +  T S  +SRK S+
Sbjct: 190 HGMIFSLSASLGIVVILVVITIFKRGKQANELCQHEKLLQTPSVKISRKWSK 241


>11_01_0607 -
           4837257-4837447,4837526-4837631,4837913-4838005,
           4838405-4838542,4838651-4838778,4838889-4839049,
           4839145-4839235,4841437-4841602
          Length = 357

 Score = 28.3 bits (60), Expect = 7.6
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -2

Query: 341 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 255
           FNT V  PI+Y  FT L   ++  +I+FK
Sbjct: 233 FNTAVVSPIYYVMFTSL--TILASVIMFK 259


>05_04_0366 -
           20663243-20663388,20663467-20663572,20664275-20664367,
           20664520-20664657,20664759-20664886,20664996-20665156,
           20665277-20665367,20665460-20665516,20666288-20666444
          Length = 358

 Score = 27.9 bits (59), Expect = 10.0
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -2

Query: 341 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 255
           FNT V  PI+Y  FT L   ++  +I+FK
Sbjct: 249 FNTAVVSPIYYTMFTSL--TILASVIMFK 275


>02_01_0498 - 3614621-3614674,3614780-3617161
          Length = 811

 Score = 27.9 bits (59), Expect = 10.0
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = -3

Query: 475 MHLYTHLGLPSFTSTALMVMLSPND-SCSAILLAYAQYGD 359
           + LY+  GLP     A   + SPND S +A L A  + GD
Sbjct: 50  VELYSRAGLPRHALLAFRALPSPNDYSYNAALSAACRAGD 89


>01_06_1567 +
           38293612-38293795,38294467-38294523,38294609-38294699,
           38294799-38294959,38295045-38295172,38295291-38295428,
           38295717-38295809,38298219-38298324,38298393-38298517
          Length = 360

 Score = 27.9 bits (59), Expect = 10.0
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -2

Query: 341 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 255
           FNT V  PI+Y  FT L   ++  +I+FK
Sbjct: 258 FNTAVVSPIYYTMFTSL--TILASVIMFK 284


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,853,109
Number of Sequences: 37544
Number of extensions: 413289
Number of successful extensions: 1117
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1089
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1117
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2185924824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -