SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120018.Seq
         (789 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1459 + 26681619-26682419,26682600-26682912,26683861-26684672     55   7e-08
04_01_0399 - 5214183-5214206,5215437-5215502,5219537-5219635,521...    50   2e-06
03_05_0952 + 29103879-29103983,29104103-29104600,29104693-291047...    50   2e-06
09_04_0287 - 16407324-16407551,16407647-16407748,16407824-164079...    50   3e-06
04_04_1247 - 32043776-32043880,32044296-32044505,32044595-320451...    48   9e-06
02_04_0056 + 19313422-19313967,19314035-19314168,19314263-193143...    48   9e-06
07_03_1696 - 28779455-28779733,28779813-28780074,28780805-287809...    47   1e-05
07_03_0481 - 18572206-18574314,18574591-18575185,18575304-185753...    47   2e-05
01_06_0919 - 32993752-32993856,32994383-32994592,32994666-329952...    46   3e-05
08_01_0540 + 4691929-4692014,4692915-4693125,4693756-4693885,469...    43   3e-04
05_01_0318 - 2488529-2489196,2489773-2490372,2490620-2490773,249...    43   3e-04
01_04_0010 - 15058175-15058195,15058320-15058430,15059031-150592...    43   3e-04
05_01_0360 + 2814139-2814627,2815203-2815334,2815480-2815583,281...    42   4e-04
06_01_1032 + 8055678-8055782,8055875-8055936,8057302-8057507,805...    42   6e-04
07_03_0149 - 14452654-14452666,14452943-14454699,14454886-144549...    42   7e-04
06_01_1034 + 8110347-8110943,8111201-8111512,8111841-8112011,811...    42   7e-04
04_04_0822 + 28352941-28353825,28353863-28354016,28354714-283547...    41   0.001
07_03_1410 + 26363538-26363777,26365421-26365475,26365553-263656...    41   0.001
03_01_0013 - 105281-105552,105762-105838,105839-106524,106655-10...    40   0.002
02_01_0102 - 749122-749799,750123-750371,750753-750851,751380-75...    40   0.002
02_05_0366 - 28313190-28313601,28313759-28314225,28315044-283157...    40   0.002
07_03_0561 + 19485218-19485242,19485323-19486467,19487354-194874...    40   0.003
03_02_1012 + 13207907-13207990,13209196-13209280,13209402-132101...    38   0.009
02_05_0844 - 32144417-32144764,32145588-32145686,32146218-321464...    38   0.009
01_06_1556 - 38222071-38222708,38222795-38222822,38222950-382230...    37   0.016
08_01_0892 - 8778097-8778236,8778390-8778486,8778568-8778747,877...    36   0.028
01_01_0020 + 147147-147313,148450-148548,148634-148742,148856-14...    36   0.028
07_03_1567 - 27772815-27773302,27773471-27773561,27773641-277739...    36   0.049
06_01_0584 - 4178391-4178732,4178854-4178915,4180361-4180481,418...    34   0.15 
02_01_0459 + 3298780-3298788,3298900-3299037,3299174-3299207,329...    34   0.15 
03_01_0455 + 3487354-3488090,3489172-3489255,3489942-3490554,349...    32   0.60 
01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237,448...    30   1.8  
12_02_0248 + 16413295-16414394,16416511-16416762,16416839-164170...    29   5.6  
12_01_0372 + 2867471-2867775,2867805-2867901,2868539-2868916           29   5.6  
09_01_0102 + 1582793-1582898,1582988-1583093,1584115-1584172,158...    29   5.6  
04_01_0484 - 6352556-6352881,6352927-6353692                           29   5.6  
07_03_1759 + 29285262-29287208                                         28   7.4  
04_04_1356 + 32854585-32854832,32854948-32855148,32855270-328554...    28   7.4  
03_05_0697 + 26888791-26888861,26890468-26890579,26891561-268917...    28   7.4  
08_02_0816 - 21499417-21499627,21502965-21503317,21505461-215056...    28   9.7  
07_03_1137 - 24220597-24220619,24220694-24221414,24221513-242217...    28   9.7  
04_01_0488 - 6419731-6420843                                           28   9.7  
04_01_0477 - 6221990-6223224,6227722-6228817                           28   9.7  
01_07_0197 + 41912207-41912652,41913226-41913800,41913828-419157...    28   9.7  

>07_03_1459 + 26681619-26682419,26682600-26682912,26683861-26684672
          Length = 641

 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 34/102 (33%), Positives = 55/102 (53%), Gaps = 12/102 (11%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML------NKNND-STNRI 161
           AL A  RW +TGTPI N  +D+Y ++ FL+ +PF+    W+ L       KNN     R+
Sbjct: 207 ALNAERRWVVTGTPIQNSSFDLYPLMAFLRFQPFSIKSYWQSLIQLPLERKNNGIGLARL 266

Query: 162 KSIIKKIVLKRDK-----SEISFNIPKHTVEYVHVNLMKKKK 272
           +S++  I L+R K     S+   +IP  TV   ++ L  +++
Sbjct: 267 QSLLGAISLRRTKETESGSKSLVSIPPKTVLACYIELSAEER 308


>04_01_0399 -
           5214183-5214206,5215437-5215502,5219537-5219635,
           5219746-5219817,5219918-5220491,5220575-5220687,
           5220842-5220941,5221059-5221181,5221268-5221335,
           5221461-5221610,5221715-5221858,5222097-5222288,
           5222710-5222794,5222892-5223043,5223138-5223296,
           5223552-5223605,5223698-5223836,5223955-5224088,
           5224200-5225117
          Length = 1121

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 6/71 (8%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML------NKNNDSTNRIKS 167
           LT+  RWC+TGTP+ N   D++S++ FL   P+ D   W  L      N +      +++
Sbjct: 695 LTSHCRWCLTGTPLQNNLEDLFSLLCFLHVEPWGDASWWNKLIQRPYENGDERGLKLVRA 754

Query: 168 IIKKIVLKRDK 200
           I++ ++L+R K
Sbjct: 755 ILRPLMLRRTK 765



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 27/81 (33%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L    +K I+ SQ+  +  + E  F QK I  L + G+L  + R      F+ + D    
Sbjct: 978  LQEKREKSIVFSQFTSFFDLLEVPFNQKGIKFLRFDGKLSQKHREKVLKEFSESKDKL-- 1035

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            +LL+S+K GGVGLNL   + +
Sbjct: 1036 VLLMSLKAGGVGLNLTAASNV 1056



 Score = 33.9 bits (74), Expect = 0.15
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = +2

Query: 239 VCTC*FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCH 418
           +  C  +E+E+  Y+ L   S+  + K VA        S L    ++L L+L+LRQ C H
Sbjct: 785 IVECEQSEDERDFYEALFRRSKVQFDKFVAQG------SVLNNYANILELLLRLRQCCDH 838

Query: 419 PYLAM 433
           P+L +
Sbjct: 839 PFLVI 843


>03_05_0952 +
           29103879-29103983,29104103-29104600,29104693-29104794,
           29105552-29105898,29105967-29106153,29106242-29106417,
           29106976-29107065,29107066-29107322,29107593-29107687,
           29107801-29107920,29108111-29108230,29108410-29108508,
           29108588-29108689,29108884-29109111
          Length = 841

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 24/82 (29%), Positives = 44/82 (53%)
 Frame = +1

Query: 520 DILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQ 699
           ++L     K+++ SQW + L I E + + K +      G +K+E+R      FN+  ++ 
Sbjct: 611 NLLLARKHKVLIFSQWTKVLDIIEYYLETKGLQVCRIDGSVKLEERRRQIAEFND-LNSS 669

Query: 700 HRILLLSIKCGGVGLNLIGGNT 765
             I +LS + GG+G+NL   +T
Sbjct: 670 MNIFILSTRAGGLGINLTSADT 691



 Score = 28.7 bits (61), Expect = 5.6
 Identities = 10/28 (35%), Positives = 19/28 (67%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFL 89
           L   N+  +TGTP+ N   +++S++NF+
Sbjct: 431 LPMDNKLLLTGTPLQNNLAELWSLLNFI 458


>09_04_0287 -
           16407324-16407551,16407647-16407748,16407824-16407922,
           16408213-16408332,16408513-16408632,16408740-16408834,
           16409109-16409365,16410134-16410309,16410401-16410587,
           16410656-16411002,16411722-16411823,16411917-16412414,
           16412520-16412624
          Length = 811

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 23/74 (31%), Positives = 41/74 (55%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K+++ SQW + L I E + + K +      G +K+E+R      FN+  ++   I +LS 
Sbjct: 589 KVLIFSQWTKVLDIIEYYLETKGLQVCRIDGSVKLEERRRQIAEFND-LNSSMNIFILST 647

Query: 724 KCGGVGLNLIGGNT 765
           + GG+G+NL   +T
Sbjct: 648 RAGGLGINLTSADT 661



 Score = 29.1 bits (62), Expect = 4.2
 Identities = 19/107 (17%), Positives = 50/107 (46%), Gaps = 17/107 (15%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML-----------------N 134
           L   N+  +TGTP+ N   +++S++NF+    F+  + ++                    
Sbjct: 431 LPMDNKLLLTGTPLQNNLAELWSLLNFILPDIFSSHQEFESWFDFSAKGGEEEQEDSEEK 490

Query: 135 KNNDSTNRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           +  D  +++ +I++  +L+R K ++   +P+     ++ N+   +K+
Sbjct: 491 RKVDVVSKLHAILRPFLLRRMKEDVEHMLPRKKEIIIYANMTDHQKQ 537


>04_04_1247 -
           32043776-32043880,32044296-32044505,32044595-32045101,
           32045362-32045583,32046054-32046184,32046737-32047745,
           32047830-32047904,32047995-32048066,32048153-32048328,
           32048494-32048646,32048739-32049234
          Length = 1051

 Score = 48.0 bits (109), Expect = 9e-06
 Identities = 27/100 (27%), Positives = 55/100 (55%), Gaps = 11/100 (11%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNK---NNDST---NRIKS 167
           L A  RWC++GTPI N   D+YS   FL+  P++    ++ + K   + D+T    ++++
Sbjct: 590 LRAKRRWCLSGTPIQNTIDDLYSYFRFLKYEPYSVYGSFRSMIKYQISRDATRGYKKLQA 649

Query: 168 IIKKIVLKRDK-----SEISFNIPKHTVEYVHVNLMKKKK 272
           ++K ++L+R K      E    +P  T++   ++  K+++
Sbjct: 650 VLKIVLLRRTKETLIDGEPIIKLPPKTIQLSKIDFSKEER 689



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 22/70 (31%), Positives = 34/70 (48%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K I+ SQW   L + E       I      G + +  R  A   FN   D + R++L+S+
Sbjct: 898  KAIVFSQWTGLLDLLELSLDSSRIKFRRLDGAMSLNLREAAVREFN--TDPEVRVMLMSL 955

Query: 724  KCGGVGLNLI 753
            K G +GLN++
Sbjct: 956  KAGNLGLNMV 965



 Score = 33.1 bits (72), Expect = 0.26
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F++EE+T Y  L+  S E + +  +A     T+   +   ++L L+L+LRQ C HP L
Sbjct: 684 FSKEERTFYMMLEEGSREKFKEYASA----GTIR--ENFANILVLLLRLRQACDHPLL 735


>02_04_0056 +
           19313422-19313967,19314035-19314168,19314263-19314398,
           19314870-19314923,19314995-19315135,19315220-19315546,
           19315647-19315916,19316080-19316226,19316890-19317045,
           19317223-19317290,19318210-19318309,19318696-19318985,
           19319074-19319274,19319840-19319902,19320263-19320356,
           19320964-19321035,19321979-19322077,19322254-19322376
          Length = 1006

 Score = 48.0 bits (109), Expect = 9e-06
 Identities = 19/36 (52%), Positives = 25/36 (69%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFND 110
           ALTA  RWC+TGTPI N   D+YS+  FL+  P+ +
Sbjct: 622 ALTADRRWCLTGTPIQNNLEDIYSLFRFLRVEPWRN 657



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 21/98 (21%)
 Frame = +1

Query: 520  DILNTSDDKIILVSQWVEYLKIF--------ENFF-------------KQKNIATLMYTG 636
            ++L TS  K I+ SQW  +L +         ENF               + N +     G
Sbjct: 829  EVLRTSGAKSIIFSQWTAFLDLLQIPLSRATENFVVPNHGYYENSCISTRHNFSFARLDG 888

Query: 637  QLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNL 750
             L ++ R      F+   D    +LL+S+K GGVG+NL
Sbjct: 889  TLNLQQREKVIKEFSE--DKSILVLLMSLKAGGVGINL 924


>07_03_1696 -
           28779455-28779733,28779813-28780074,28780805-28780956,
           28781765-28781961,28782258-28782462,28782737-28782982,
           28783603-28783719,28784206-28784397,28784480-28784693,
           28784835-28784926,28784952-28785001,28785494-28785812,
           28785908-28786068,28786407-28786650,28787212-28787467,
           28787634-28787834,28788568-28788910,28789003-28789064,
           28789645-28789851,28790170-28790978
          Length = 1535

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 18/39 (46%), Positives = 26/39 (66%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVW 122
           L A +RWCITGTPI  +  D++ ++ FL+  PF+  R W
Sbjct: 579 LNAQHRWCITGTPIQRRLDDLFGLLRFLKTHPFDTYRWW 617



 Score = 28.7 bits (61), Expect = 5.6
 Identities = 10/17 (58%), Positives = 12/17 (70%)
 Frame = +2

Query: 389 ILKLRQICCHPYLAMHG 439
           +LKLRQ CCHP +   G
Sbjct: 729 LLKLRQACCHPQVGSFG 745


>07_03_0481 - 18572206-18574314,18574591-18575185,18575304-18575371,
            18577344-18577458,18578179-18578333,18578673-18580621,
            18580691-18581372,18581550-18581621,18582558-18583199,
            18583301-18583402,18585011-18585100
          Length = 2192

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 5/89 (5%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDST-----NRIKSI 170
            L+  +R  +TGTP+ N   +MY+++NFLQ  P + P +     K ND T       +K++
Sbjct: 766  LSFQHRVLLTGTPLQNNIGEMYNLLNFLQ--PASFPSLASFEEKFNDLTTTEKVEELKNL 823

Query: 171  IKKIVLKRDKSEISFNIPKHTVEYVHVNL 257
            +   +L+R K +   NIP  T   V V L
Sbjct: 824  VAPHMLRRLKKDAMQNIPPKTERMVPVEL 852



 Score = 34.7 bits (76), Expect = 0.085
 Identities = 29/106 (27%), Positives = 51/106 (48%), Gaps = 9/106 (8%)
 Frame = +1

Query: 478  LYEQQVQTSA-----HLVDDILNTSDDKIILVSQWVEYLKIFENF----FKQKNIATLMY 630
            L+E +++ SA     H +  IL+    ++++ SQ  + L I E++    F  K    +  
Sbjct: 913  LHEMRIKASAKLTLLHSMLKILHKDGHRVLIFSQMTKLLDILEDYLTWEFGPKTFERV-- 970

Query: 631  TGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
             G + V +R  A   FN   D    + LLS +  G+G+NL   +T+
Sbjct: 971  DGSVSVAERQAAIARFNQ--DKSRFVFLLSTRSCGLGINLATADTV 1014


>01_06_0919 - 32993752-32993856,32994383-32994592,32994666-32995220,
            32995705-32995926,32996381-32996511,32997456-32998353,
            32998453-32998530,32998612-32998683,32998728-32998763,
            32999413-33000353,33000531-33000659,33000751-33000894,
            33000994-33001060,33002434-33002502,33003144-33003278
          Length = 1263

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 6/72 (8%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTN------RIKS 167
            L A  RWC++GTPI N   D+YS   FL+  P+ + + +  + K   S N      +++ 
Sbjct: 786  LRAKRRWCLSGTPIQNAVEDLYSYFRFLRYDPYAEYKKFCFMIKTPISRNPITGYKKLQV 845

Query: 168  IIKKIVLKRDKS 203
            ++K ++L+R K+
Sbjct: 846  VLKTVMLRRTKA 857



 Score = 38.7 bits (86), Expect = 0.005
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = +2

Query: 254  FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
            F  EE+  Y+ L+ ES E + +  AA     T+   Q   ++L ++L+LRQ C HP+L
Sbjct: 880  FTSEERAFYNTLEAESREQFKEYAAA----GTVK--QNYVNILLMLLRLRQACDHPHL 931



 Score = 37.9 bits (84), Expect = 0.009
 Identities = 19/71 (26%), Positives = 35/71 (49%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLS 720
            +K I+ SQW   L + E   K  +++     G + V  R  A   FN   +    ++++S
Sbjct: 1109 EKAIVFSQWTRMLDLVEVHLKSSHLSYRRLDGTMSVAARDRAVKDFNTNPEVS--VMIMS 1166

Query: 721  IKCGGVGLNLI 753
            +K   +GLN++
Sbjct: 1167 LKAASLGLNMV 1177


>08_01_0540 + 4691929-4692014,4692915-4693125,4693756-4693885,
            4695422-4696072,4696179-4696395,4697040-4697111,
            4697167-4697257,4697367-4698363,4698914-4699044,
            4699584-4699802,4700110-4700805,4700912-4701121,
            4701606-4701710
          Length = 1271

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 25/100 (25%), Positives = 53/100 (53%), Gaps = 11/100 (11%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTN------RIKS 167
            L A  RWC++GTPI N   ++YS  +FL+  P++    +  + K+  + N      ++++
Sbjct: 748  LRAKRRWCLSGTPIQNAIDELYSYFHFLKYDPYSTYNSFCTMIKHPIARNAVHGYKKLQT 807

Query: 168  IIKKIVLKRDK-----SEISFNIPKHTVEYVHVNLMKKKK 272
            +++ ++L+R K      E    +P  T+    V+  K+++
Sbjct: 808  VLRIVLLRRTKETLIDGEPIIKLPPKTINLDKVDFTKEER 847



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 21/70 (30%), Positives = 34/70 (48%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            K I+ SQW   L + E       I      G + +  R  A   FN   D + R++++S+
Sbjct: 1118 KAIVFSQWTGMLDLLELSLNSNLIQYRRLDGTMSLNSRDKAVKDFN--TDPEVRVMIMSL 1175

Query: 724  KCGGVGLNLI 753
            K G +GLN++
Sbjct: 1176 KAGNLGLNMV 1185



 Score = 32.7 bits (71), Expect = 0.34
 Identities = 22/58 (37%), Positives = 32/58 (55%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           F +EE+  Y  L+  S + + KA AA     TL   Q   ++L ++L+LRQ C HP L
Sbjct: 842 FTKEERAFYLTLEERSRQQF-KAYAAA---GTLK--QNYANILLMLLRLRQACDHPLL 893


>05_01_0318 -
           2488529-2489196,2489773-2490372,2490620-2490773,
           2490996-2491085,2491926-2492061,2492159-2492418,
           2493448-2493846,2494482-2494661,2494728-2494922,
           2496614-2496678,2497186-2497321,2497442-2497483,
           2498351-2498689
          Length = 1087

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 24/81 (29%), Positives = 41/81 (50%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  +  +++L SQ  + L I E + +      +   G  K E+R      FN   D+++ 
Sbjct: 718 LQRAGHRVLLFSQMTKLLDILEVYLQMYQFKYMRLDGSTKTEERGRLLADFNKK-DSEYF 776

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS + GG+GLNL   +T+
Sbjct: 777 LFLLSTRAGGLGLNLQTADTV 797


>01_04_0010 -
           15058175-15058195,15058320-15058430,15059031-15059246,
           15059327-15059505,15059655-15059820,15059914-15059972,
           15060065-15060107,15060285-15060354,15060458-15060547,
           15060621-15060742,15060777-15060808,15060876-15061064,
           15061148-15061241,15061325-15061412,15061498-15061718,
           15061924-15061997,15062081-15062363,15062455-15062589,
           15062721-15062942,15063029-15063208,15063305-15063402,
           15063522-15063634,15064156-15064259,15064400-15064522,
           15064857-15065192
          Length = 1122

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 25/91 (27%), Positives = 49/91 (53%), Gaps = 8/91 (8%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRV---WKMLNKNNDS---TNRIKSIIKKI 182
           R  ITGTP+ N   +++S++NFL    F+       W  ++  ND      ++  +++  
Sbjct: 383 RLLITGTPLQNNLHELWSLLNFLLPEIFSSAETFDEWFQISGENDQQEVVQQLHKVLRPF 442

Query: 183 VLKRDKSEISFNIP--KHTVEYVHVNLMKKK 269
           +L+R KS++   +P  K T+  V ++ M+K+
Sbjct: 443 LLRRLKSDVEKGLPPKKETILKVGMSQMQKQ 473



 Score = 38.7 bits (86), Expect = 0.005
 Identities = 21/75 (28%), Positives = 35/75 (46%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L   D ++++ SQ    L I E++   +        G    EDR  +   FN    ++  
Sbjct: 544 LKDRDSRVLIFSQMTRLLDILEDYLMYRGYQYCRIDGNTGGEDRDASIEAFNKPG-SEKF 602

Query: 706 ILLLSIKCGGVGLNL 750
           + LLS + GG+G+NL
Sbjct: 603 VFLLSTRAGGLGINL 617


>05_01_0360 +
           2814139-2814627,2815203-2815334,2815480-2815583,
           2816180-2816292,2818409-2818506,2818636-2818815,
           2818893-2819114,2819270-2819404,2819489-2819771,
           2819858-2819931,2820164-2820384,2820463-2820550,
           2820651-2820744,2820827-2821015,2821369-2821400,
           2821542-2821621,2821718-2821807,2821911-2821980,
           2822240-2822285,2822370-2822428,2822588-2822753,
           2822929-2823107,2823186-2823392,2823529-2823633,
           2823701-2823703
          Length = 1152

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 25/91 (27%), Positives = 49/91 (53%), Gaps = 8/91 (8%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRV---WKMLNKNNDS---TNRIKSIIKKI 182
           R  ITGTP+ N   +++S++NFL    F+       W  ++  ND      ++  +++  
Sbjct: 437 RLLITGTPLQNNLHELWSLLNFLLPEIFSSAETFDDWFQISGENDQHEVVQQLHKVLRPF 496

Query: 183 VLKRDKSEISFNIP--KHTVEYVHVNLMKKK 269
           +L+R KS++   +P  K T+  V ++ M+K+
Sbjct: 497 LLRRLKSDVEKGLPPKKETILKVGMSEMQKQ 527



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 22/75 (29%), Positives = 35/75 (46%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L   D ++++ SQ    L I E++   K        G    EDR  +   FN    ++  
Sbjct: 598 LKERDSRVLIFSQMTRLLDILEDYLMYKGYQYCRIDGNTGGEDRDASIEAFNKPG-SEKF 656

Query: 706 ILLLSIKCGGVGLNL 750
           + LLS + GG+G+NL
Sbjct: 657 VFLLSTRAGGLGINL 671


>06_01_1032 + 8055678-8055782,8055875-8055936,8057302-8057507,
            8057595-8058314,8058404-8058603,8058988-8059172,
            8059287-8059354,8059432-8060246,8060502-8060599,
            8060702-8060887,8061358-8061538,8061651-8061812,
            8061894-8061937,8062059-8062115,8062409-8062505,
            8062614-8062786,8062868-8063081,8063270-8063395,
            8064072-8064188,8064459-8064566,8064729-8064898,
            8065049-8065127,8065211-8065285,8065845-8065942,
            8066030-8066137,8066238-8066295,8066527-8066631,
            8067461-8069516,8069804-8070697,8070896-8071852,
            8072022-8072075,8072157-8072222,8072294-8073472,
            8073868-8075598,8075764-8075829,8076763-8077788,
            8077893-8078041
          Length = 4264

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 40/81 (49%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  +++L S     L + E++   K    L   G    ++R      FNN  ++Q  
Sbjct: 1302 LKATGHRVLLFSTMTRLLDVMEDYLVWKKYKYLRLDGHTSGQERGALIDKFNNP-NSQAF 1360

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLSI+ GGVG+NL   +T+
Sbjct: 1361 IFLLSIRAGGVGVNLQAADTV 1381



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVW--KMLNKNNDST 152
            +++R  +TGTP+ N   ++++++NFL    FN   D   W  K    N DS+
Sbjct: 1179 SSHRLLLTGTPLQNNLEELWALLNFLLPNIFNSSEDFSQWFNKPFESNGDSS 1230


>07_03_0149 - 14452654-14452666,14452943-14454699,14454886-14454990,
            14455808-14455978,14456309-14456641,14456900-14457492,
            14458864-14458906
          Length = 1004

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 5/85 (5%)
 Frame = +1

Query: 523  ILNTSDDKIILVSQWVEYLKIFENFFKQK-----NIATLMYTGQLKVEDRILAETTFNNA 687
            + N++ +K++  SQ++  +K  E    ++          M +G    +DR +A   FNN+
Sbjct: 818  LANSAGEKLLAFSQYILPMKFLERLLVKRLGWHVGKEIFMISGDTSADDREVAMDQFNNS 877

Query: 688  ADTQHRILLLSIKCGGVGLNLIGGN 762
            AD   ++L  SIK  G G++L+G +
Sbjct: 878  ADA--KVLFGSIKACGEGISLVGAS 900


>06_01_1034 + 8110347-8110943,8111201-8111512,8111841-8112011,
            8112780-8114576
          Length = 958

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 5/85 (5%)
 Frame = +1

Query: 523  ILNTSDDKIILVSQWVEYLKIFENFFKQK-----NIATLMYTGQLKVEDRILAETTFNNA 687
            + N++ +K++  SQ++  +K  E    ++          M +G    +DR +A   FNN+
Sbjct: 763  LANSAGEKLLAFSQYILPMKFLERLLVKRLGWHVGKEIFMISGDTSADDREVAMDQFNNS 822

Query: 688  ADTQHRILLLSIKCGGVGLNLIGGN 762
            AD   ++L  SIK  G G++L+G +
Sbjct: 823  ADA--KVLFGSIKACGEGISLVGAS 845


>04_04_0822 +
           28352941-28353825,28353863-28354016,28354714-28354754,
           28355060-28355310,28355411-28355591,28356138-28356323,
           28356396-28356569,28356992-28357150,28357424-28357501,
           28357612-28357748,28357980-28358044,28358115-28358148,
           28358216-28358372,28359135-28359196,28360041-28360118,
           28360940-28361042
          Length = 914

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 23/69 (33%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = +3

Query: 12  ATNRWCITGTPIHNKHWDMYSMINFLQCRPF--NDPRVWKMLN-KNNDSTNRIKSIIKKI 182
           A  R  +TGTP+ N   +++S++ F+    F   D  + K+LN ++++  +RIKSI+   
Sbjct: 488 ARQRLMLTGTPLQNDLHELWSLLEFMMPDIFATGDIDLKKLLNAEDHELISRIKSILGPF 547

Query: 183 VLKRDKSEI 209
           +L+R KS++
Sbjct: 548 ILRRLKSDV 556


>07_03_1410 +
           26363538-26363777,26365421-26365475,26365553-26365644,
           26365732-26365787,26366026-26366101,26366790-26366856,
           26367197-26367263,26368276-26368342,26368759-26368842,
           26369749-26369904,26370641-26370718,26371323-26371391,
           26371476-26371541,26371623-26371751,26372862-26372951,
           26373306-26373371,26373768-26373836,26373903-26374007,
           26374374-26374499,26374687-26374745,26374832-26374868,
           26375370-26375519
          Length = 667

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 31/110 (28%), Positives = 46/110 (41%), Gaps = 3/110 (2%)
 Frame = +1

Query: 448 FGNKRLF*NGLYEQQVQTSAHLVDDILNT---SDDKIILVSQWVEYLKIFENFFKQKNIA 618
           F  K L  N +Y    +     V D L T   ++ K ++ +     L+       +K + 
Sbjct: 456 FAQKNLI-NKIYNDSAEAKIPAVLDYLGTIIEAECKFLIFAHHQSMLEAIHQHLLKKKVK 514

Query: 619 TLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            +   GQ  V  R    T F N  D +  +L  SIK GGVGL L   +T+
Sbjct: 515 CIRIDGQTPVPVRQTLVTDFQNKDDIKAAVL--SIKAGGVGLTLTAASTV 562


>03_01_0013 -
           105281-105552,105762-105838,105839-106524,106655-106738,
           106914-107114,107202-107309,107766-107855,108505-108551,
           109096-109276,110010-110135,110220-110386,110877-111072
          Length = 744

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 14/109 (12%)
 Frame = +1

Query: 484 EQQVQTSAHLV--DDILNTSDD---KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKV 648
           E  VQ S  LV  D IL    +   +++L +Q  + L I ++F + +        G ++ 
Sbjct: 265 EHLVQASGKLVMLDLILKKLHEVGHRVLLFAQMTQTLDILQDFLELRQYTYERLDGSVRA 324

Query: 649 EDRILAETTFNNAA-------DTQHR--ILLLSIKCGGVGLNLIGGNTL 768
           E+R  A  +F++         D Q    + ++S + GGVGLNLIG +T+
Sbjct: 325 EERFAAIKSFSSQPTKGVVRDDNQSGAFVFMISTRAGGVGLNLIGADTV 373


>02_01_0102 - 749122-749799,750123-750371,750753-750851,751380-751889,
            752025-753905,754093-754296,754807-754899,755036-755122,
            755241-755328,755533-755645,755943-757259,757398-758672,
            759166-759273
          Length = 2233

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 25/81 (30%), Positives = 40/81 (49%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L+ S  +++L S   + L I E + + + +      G   +EDR  A   FN   ++   
Sbjct: 1305 LHRSGHRVLLFSTMTKLLDILEEYLQWRQLVYRRIDGTTSLEDRESAIVDFNR-PNSDCF 1363

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            I LLSI+  G GLNL   +T+
Sbjct: 1364 IFLLSIRAAGRGLNLQSADTV 1384


>02_05_0366 - 28313190-28313601,28313759-28314225,28315044-28315782,
            28316548-28316615,28316693-28316757,28316922-28320162,
            28320239-28320301,28320756-28320824,28321020-28321055,
            28322035-28322280,28322531-28322569,28322695-28322816,
            28322921-28323004,28323100-28323235,28323486-28323535,
            28323620-28323756,28323863-28323951,28324847-28324954,
            28325080-28325163,28325841-28325888,28326036-28326153,
            28328262-28328347
          Length = 2168

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 22/81 (27%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L +   + ++ +Q  + L I E F        L   G  + E+R      FN   + +  
Sbjct: 1215 LKSEGHRALIFTQMTKMLDILEEFINLYGYTYLRLDGSTQPEERQTLMQRFNT--NPKFF 1272

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + +LS + GGVG+NL+G +T+
Sbjct: 1273 LFILSTRSGGVGINLVGADTV 1293



 Score = 32.3 bits (70), Expect = 0.45
 Identities = 19/97 (19%), Positives = 49/97 (50%), Gaps = 13/97 (13%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------ML----NKNNDSTNRI 161
            R  +TGTP+ N   +++S+++FL    F   + +K         M+      N +  +R+
Sbjct: 820  RILLTGTPLQNDLMELWSLMHFLMPHVFQSHQEFKDWFCNPISGMVEGQDKVNKEVIDRL 879

Query: 162  KSIIKKIVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
             ++++  +L+R K ++   +P+     ++  L ++++
Sbjct: 880  HNVLRPFILRRLKRDVEKQLPQKHEHVIYCRLSRRQR 916



 Score = 31.9 bits (69), Expect = 0.60
 Identities = 18/68 (26%), Positives = 36/68 (52%)
 Frame = +2

Query: 260  EEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAMHG 439
            + E  +Y +L       Y   +A+ E++ TL+       ++ +I++LR++C HP L   G
Sbjct: 902  KHEHVIYCRLSRRQRNLYEDFIASSETQATLASGNYFG-MISIIMQLRKVCNHPDL-FEG 959

Query: 440  RNLLETND 463
            R ++ + D
Sbjct: 960  RPIISSFD 967


>07_03_0561 +
           19485218-19485242,19485323-19486467,19487354-19487476,
           19487553-19487626,19487886-19487946,19488285-19488370,
           19488795-19488864,19489026-19489122,19489342-19489481,
           19490225-19490308,19490313-19490346,19491833-19491951
          Length = 685

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 14/36 (38%), Positives = 26/36 (72%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHNKHWDMYSMINFLQCRPFND 110
           AL +  +W ++GTP+ N+  ++YS+I FLQ  P+++
Sbjct: 407 ALESEYKWALSGTPLQNRVGELYSLIRFLQIFPYSN 442


>03_02_1012 + 13207907-13207990,13209196-13209280,13209402-13210186,
            13210262-13210462,13210580-13210690,13211105-13211487,
            13211594-13211702,13211786-13211866,13212088-13212156,
            13212379-13212467,13212619-13212780,13212859-13212916,
            13213143-13213373,13213516-13213662,13213779-13214333,
            13214562-13214819,13215096-13215203,13215760-13215854,
            13215946-13216102,13216466-13216666,13217542-13217670,
            13218292-13218567
          Length = 1457

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 21/81 (25%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L   + +++L +Q  + L I E++   +        G   + DR      F N  D    
Sbjct: 1151 LRAENHRVLLFAQMTKMLDILEDYMNFRKFKYFRLDGSSAISDRRDMVRDFQNRNDIF-- 1208

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1209 VFLLSTRAGGLGINLTAADTV 1229


>02_05_0844 -
           32144417-32144764,32145588-32145686,32146218-32146410,
           32147049-32147107,32147189-32147263,32147557-32147670,
           32147776-32147895,32148204-32148216,32148421-32148512,
           32149078-32149164,32149254-32149328,32149630-32149680,
           32149852-32149947,32150135-32150221,32150312-32150368,
           32150475-32150600,32150709-32150949,32151028-32151114,
           32151260-32151637,32152847-32153187
          Length = 912

 Score = 37.9 bits (84), Expect = 0.009
 Identities = 20/64 (31%), Positives = 31/64 (48%)
 Frame = +1

Query: 577 LKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIG 756
           L +F    +++    +   G   +  R      FN+ +  +  + LLS K GG GLNL+G
Sbjct: 579 LDLFAQLCRERRYPYIRLDGATSINKRQKLVNQFNDPSRDEF-VFLLSSKAGGCGLNLVG 637

Query: 757 GNTL 768
           GN L
Sbjct: 638 GNRL 641


>01_06_1556 -
           38222071-38222708,38222795-38222822,38222950-38223070,
           38223206-38223318,38223424-38223506,38223868-38223930,
           38224100-38224254,38224411-38224580,38225101-38225189,
           38225304-38225496,38225655-38225779,38226069-38226475,
           38226855-38226919,38227414-38227692,38227772-38227845,
           38228241-38228292,38228366-38228473,38228871-38228972,
           38229100-38229173,38229262-38229435,38229667-38229771,
           38229867-38229977,38230364-38230487
          Length = 1150

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 8/71 (11%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPR---VWKMLNKNNDST-----NRIKSIIK 176
           R  +TGTP+ N   +++S+++++    F+DP+   ++  +    D T      RI +I+K
Sbjct: 690 RLLLTGTPLQNNIMELFSLLHYIDPDEFSDPKADGLFSPIESGRDLTMDEKVARIHNILK 749

Query: 177 KIVLKRDKSEI 209
             +L+R KS++
Sbjct: 750 PRMLRRMKSDV 760


>08_01_0892 -
           8778097-8778236,8778390-8778486,8778568-8778747,
           8779138-8779247,8781153-8781294,8782298-8782686,
           8782752-8782834,8783524-8785244,8785894-8786040,
           8786121-8786264,8786669-8786741,8787413-8787633
          Length = 1148

 Score = 36.3 bits (80), Expect = 0.028
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 5/87 (5%)
 Frame = +1

Query: 523 ILNTSDDKIILVSQWVEYLKIFENFFKQK-----NIATLMYTGQLKVEDRILAETTFNNA 687
           + N++ +K++  SQ+   +K  E    ++          +  G   +ED  LA   FN +
Sbjct: 586 LANSAGEKLVAFSQYTLPMKFLERLLVKEMGWHVGKEIFVINGDTSMEDGQLAMDQFNGS 645

Query: 688 ADTQHRILLLSIKCGGVGLNLIGGNTL 768
           AD   ++L  SIK  G G++L+G + +
Sbjct: 646 ADA--KVLFGSIKAFGEGISLVGASRI 670


>01_01_0020 + 147147-147313,148450-148548,148634-148742,148856-148927,
            149056-149061,150811-150915,151048-151539,151629-152025,
            152178-153646,154010-154450,154543-155214
          Length = 1342

 Score = 36.3 bits (80), Expect = 0.028
 Identities = 22/75 (29%), Positives = 34/75 (45%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            +++L +Q  + L I ENF            G    + R+     FNN  +    I +L+ 
Sbjct: 886  RVLLFTQTQQMLDIMENFLTACEYQYRRMDGLTPAKQRMALIDEFNNTDEIF--IFILTT 943

Query: 724  KCGGVGLNLIGGNTL 768
            K GG+G NL G N +
Sbjct: 944  KVGGLGTNLTGANRI 958


>07_03_1567 - 27772815-27773302,27773471-27773561,27773641-27773988,
            27774929-27775110,27775191-27775368,27775453-27775605,
            27775993-27776232,27776369-27776449,27776485-27776730,
            27777151-27777240,27777536-27777778,27778365-27778529,
            27779017-27779080,27779162-27779286,27779383-27779476,
            27779647-27779714,27779798-27779989,27780618-27780752,
            27780847-27780934,27781014-27781107,27781484-27781547,
            27781657-27781708,27781911-27782014,27782099-27782158,
            27782687-27782770,27782892-27783125,27783442-27783864,
            27784675-27784736,27784867-27785521
          Length = 1700

 Score = 35.5 bits (78), Expect = 0.049
 Identities = 21/91 (23%), Positives = 48/91 (52%), Gaps = 5/91 (5%)
 Frame = +3

Query: 18   NRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTN--RIKSIIKKI--- 182
            N+  ITGTP+ N   +++++++FL    FN   ++    KN  S N   + ++ K++   
Sbjct: 755  NKLLITGTPLQNSVEELWALLHFLDPSKFNSKDIFVERYKNLSSFNETELANLHKELRPH 814

Query: 183  VLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
            +L+R   ++  ++P      + V++   +K+
Sbjct: 815  ILRRVIKDVEKSLPPKIERILRVDMSPLQKQ 845



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 2/80 (2%)
 Frame = +1

Query: 535  SDDKIILVSQ--WVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRI 708
            S  K++L+ +   V  L I   +   +        G  + + R  A   FN A  +    
Sbjct: 910  SSGKLVLLDKLLMVRMLDILAEYLSLRGFQFQRLDGSTRADLRHQAMEHFN-APGSDDFC 968

Query: 709  LLLSIKCGGVGLNLIGGNTL 768
             LLS + GG+G+NL   +T+
Sbjct: 969  FLLSTRAGGLGINLATADTV 988


>06_01_0584 -
           4178391-4178732,4178854-4178915,4180361-4180481,
           4180592-4180732,4180830-4180959,4182306-4182436,
           4182528-4182601,4182680-4182741,4183135-4183209,
           4184658-4184760,4184835-4184991,4185549-4185743,
           4186204-4186282,4186697-4186806,4187249-4187374,
           4187475-4187541,4187622-4187791,4187880-4188018,
           4188361-4188522,4188672-4188772,4188852-4188994,
           4189438-4189537,4190364-4190414,4191062-4191169,
           4191279-4191494,4191585-4191721,4191820-4191915,
           4192017-4192234,4192764-4192925,4193006-4193163,
           4194221-4194379
          Length = 1364

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 20/89 (22%), Positives = 45/89 (50%), Gaps = 4/89 (4%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFND----PRVWKMLNKNNDSTNRIKSIIKKIV 185
           +R  +TGTP+ N   +++ +++FL+   F         +K +N++     ++  ++K  +
Sbjct: 408 HRVLLTGTPVQNNLDELFMLMHFLEGDSFGSIADLQEEFKDINQDK-QVEKLHGMLKPHL 466

Query: 186 LKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
           L+R K ++   +P      + V L  K+K
Sbjct: 467 LRRFKKDVMKELPPKKELILRVELTSKQK 495



 Score = 33.5 bits (73), Expect = 0.20
 Identities = 19/81 (23%), Positives = 40/81 (49%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ+   L + E++   +  +     G++   +R +    FN A ++   
Sbjct: 623 LKEQGHRVLIYSQFQHMLDLLEDYLSYRKWSYERIDGKIGGAERQIRIDRFN-AKNSTRF 681

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
             LLS + GG+G+NL   +T+
Sbjct: 682 CFLLSTRAGGLGINLATADTV 702



 Score = 28.3 bits (60), Expect = 7.4
 Identities = 10/42 (23%), Positives = 24/42 (57%)
 Frame = +2

Query: 302 EEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           ++ Y KA+  +  E    R      ++ ++++LR++CCH ++
Sbjct: 494 QKEYYKAILTKNYEVLTRRSGGHVSLINVVMELRKLCCHAFM 535


>02_01_0459 + 3298780-3298788,3298900-3299037,3299174-3299207,
            3299528-3299531,3299814-3299949,3300034-3300090,
            3301689-3301786,3301876-3301947,3302056-3302228,
            3302552-3302698,3303113-3303336,3305300-3305306,
            3305634-3305800,3306033-3306068,3306787-3307004,
            3307115-3307172,3307761-3307842,3308045-3308207,
            3308594-3308598,3308700-3308885,3308969-3309548,
            3309642-3309774,3309880-3309948,3310184-3310395,
            3310654-3310891,3311228-3311386,3311501-3311926,
            3312010-3312447,3312593-3312712,3312784-3313266,
            3313471-3314009,3314178-3314667,3314836-3314904,
            3315735-3315839,3315940-3316158,3316254-3316508,
            3316602-3316651,3317175-3317284,3317372-3317454,
            3317560-3317772,3317870-3318040
          Length = 2391

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHRILL 714
            ++++ +Q    L I E    Q ++ ++ Y    G ++ E R      FN+  D    +LL
Sbjct: 2175 RVLIFAQHKALLDIIEKDLFQSHMRSVTYLRLDGSVEPEKRFEIVKAFNS--DPTIDVLL 2232

Query: 715  LSIKCGGVGLNLIGGNTL 768
            L+   GG+GLNL   +TL
Sbjct: 2233 LTTHVGGLGLNLTSADTL 2250


>03_01_0455 + 3487354-3488090,3489172-3489255,3489942-3490554,
            3491356-3491583,3492270-3492437,3492828-3494587,
            3494667-3494670
          Length = 1197

 Score = 31.9 bits (69), Expect = 0.60
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 8/96 (8%)
 Frame = +1

Query: 505  AHLVDDILNTSD---DKIILVSQWVEYLKIFENFFKQ-----KNIATLMYTGQLKVEDRI 660
            A  V ++L+ S+    K+++ SQ+V  L   E    +       +     TG    + R 
Sbjct: 1005 AKFVHNLLSLSEATGGKVLVFSQYVRSLIFLEKLVSRMKGWKSEVHIFRVTGGSTQDQRE 1064

Query: 661  LAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
             A   FNN+ D   R+   SIK  G G++L+G + +
Sbjct: 1065 QAVHRFNNSPDA--RVFFGSIKACGEGISLVGASRI 1098


>01_01_0602 -
           4484972-4485450,4485949-4485997,4486108-4486237,
           4486636-4486778,4486819-4486877,4487167-4487200,
           4487489-4487629,4487719-4487907,4488027-4488122,
           4488163-4488225,4488588-4489097
          Length = 630

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 21/96 (21%), Positives = 45/96 (46%), Gaps = 4/96 (4%)
 Frame = +1

Query: 475 GLYEQQVQTSAHLV-DDILNTS---DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQL 642
           GL  Q V  S+ LV + +L  S    +K+++    +   +  ++F  +  I+T+ Y G++
Sbjct: 348 GLQSQSVDHSSFLVLNMVLEPSLAKGNKVMVFCNTLNSSRAVDHFLTENQISTVNYHGEV 407

Query: 643 KVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNL 750
             E+R+     F N       ++   +   G+ L++
Sbjct: 408 PAEERVENLNKFRNEEGDCPTLVCTDLAARGLDLDV 443


>12_02_0248 +
           16413295-16414394,16416511-16416762,16416839-16417055,
           16417216-16417353,16417493-16417669,16417744-16417851,
           16417925-16418392,16418493-16418570,16418673-16418756
          Length = 873

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +3

Query: 105 NDPRVWKMLNKNNDSTNRIKSIIKKIVLKRDKSE 206
           NDPR  + L  N D+TN+I+ + +++  +R+  E
Sbjct: 722 NDPRPRRRLRTNPDNTNQIEDLERQLQEEREARE 755


>12_01_0372 + 2867471-2867775,2867805-2867901,2868539-2868916
          Length = 259

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +1

Query: 25  GASPAHRSTTNTGICTR*LIFCNVVLLTIQECGKC 129
           G SP  +S    G CTR L++C V       C  C
Sbjct: 195 GGSPGDKSPMVIGACTRCLMYCMVAKKDYPTCINC 229


>09_01_0102 +
           1582793-1582898,1582988-1583093,1584115-1584172,
           1584676-1584745,1585132-1585197,1586374-1586429,
           1587992-1588078,1588819-1589139,1589827-1589946,
           1590747-1590881,1591529-1591605,1591681-1591756,
           1592800-1592874,1592971-1593075,1593299-1593374,
           1594482-1594617,1594702-1594804,1595186-1595298,
           1596907-1597111,1597173-1597301,1597403-1597517,
           1597710-1597795,1599108-1599203,1599615-1599751,
           1600374-1600476,1601809-1601888,1602013-1602091,
           1602241-1602298,1602489-1602586,1602673-1602767,
           1602861-1602918
          Length = 1074

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 13/47 (27%), Positives = 27/47 (57%)
 Frame = -3

Query: 262 FIKLTCTYSTVCLGMLKEISDLSRFKTIFLIILFMRFVESLFLFNIF 122
           FIK  C+Y+ + + +  +  D  + + +  +IL + F+++L L N F
Sbjct: 65  FIKTDCSYAAIIVDINNQGEDAFKPEAVVSLILPLPFIKNLRLVNQF 111


>04_01_0484 - 6352556-6352881,6352927-6353692
          Length = 363

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = -3

Query: 592 FQIFLNIPPIAKPILSCRRSCSKCRLLNEHSFALAAHIIHFKTV 461
           ++I + +PP  KP+L CR+ C   R L      L  H  H  T+
Sbjct: 23  WEILVRLPP--KPLLRCRQVCRAWRRLTSTGDFLLTHHRHQPTL 64


>07_03_1759 + 29285262-29287208
          Length = 648

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +1

Query: 646 VEDRILAETTFNNAADTQHRILLLSIKCGGVGL 744
           ++ R+LA  + N +ADTQ R L+L   C  +GL
Sbjct: 196 LKHRVLAGFSKNTSADTQWRYLVLGQACFHLGL 228


>04_04_1356 +
           32854585-32854832,32854948-32855148,32855270-32855447,
           32856389-32856651,32856800-32857040,32857317-32858456,
           32858856-32858993
          Length = 802

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = -3

Query: 235 TVCLGMLKEISDLSRFKTIFLIILFMRFVESLFLFNIFHTLGSLKG 98
           +VC+ +L+  ++L     + L++L  + V   F  NI+  L  LKG
Sbjct: 544 SVCVVILELTNNLLMLPLVMLVLLISKTVADAFNANIYDLLVKLKG 589


>03_05_0697 +
           26888791-26888861,26890468-26890579,26891561-26891757,
           26892215-26892266,26893530-26893795,26894007-26894229,
           26895154-26895327,26895408-26895485,26895566-26895817,
           26896138-26898204,26899477-26901322,26901474-26901574,
           26902179-26902535,26902681-26902799,26903558-26903559,
           26903630-26903662,26903709-26903841,26904285-26904537,
           26905688-26905912,26906401-26906466,26907373-26907471,
           26908528-26908545,26908546-26908893,26909878-26910354
          Length = 2522

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 14/41 (34%), Positives = 27/41 (65%)
 Frame = +3

Query: 129 LNKNNDSTNRIKSIIKKIVLKRDKSEISFNIPKHTVEYVHV 251
           +N+ + S + + S+ K+I+   DK  ISF++PK  V++ H+
Sbjct: 284 MNQTSKSKSILPSLKKQILAFPDK--ISFSVPKLDVKFTHL 322


>08_02_0816 -
           21499417-21499627,21502965-21503317,21505461-21505649,
           21505819-21505973,21506026-21506245
          Length = 375

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 10/37 (27%), Positives = 21/37 (56%)
 Frame = +2

Query: 254 FNEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQ 364
           F    ++LY+ +KC  E+ ++  +AA ++E     +Q
Sbjct: 332 FRPASQSLYETVKCLQEKGHLPVLAAEKTEEEAGEVQ 368


>07_03_1137 -
           24220597-24220619,24220694-24221414,24221513-24221731,
           24221805-24222505,24223127-24223376
          Length = 637

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +2

Query: 413 CHPYLAMHGRNLLETNDCFKMDYMSSKCKRVL 508
           C PYL +HG++   +N   K+ Y   K K+ L
Sbjct: 281 CRPYLRVHGQDSSSSNKSAKVLYEMPKTKKHL 312


>04_01_0488 - 6419731-6420843
          Length = 370

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 592 FQIFLNIPPIAKPILSCRRSCSKC-RLLNEHSFALAAH 482
           ++I + +PP  KP+L CR  C    RL +   F LA H
Sbjct: 21  WEILVRLPP--KPLLRCRLVCRAWRRLTSTRGFLLAHH 56


>04_01_0477 - 6221990-6223224,6227722-6228817
          Length = 776

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = -3

Query: 592 FQIFLNIPPIAKPILSCRRSCSKC-RLLNEHSFALAAH 482
           ++I + +PP  KP+L CR  C    RL +   F LA H
Sbjct: 25  WEILVRLPP--KPLLRCRLVCRAWRRLTSTRDFLLAHH 60


>01_07_0197 +
           41912207-41912652,41913226-41913800,41913828-41915748,
           41915836-41916049,41916143-41916394,41916469-41916528,
           41916646-41916776,41916898-41917012,41917084-41917239
          Length = 1289

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = +3

Query: 3   ALTATNRWCITGTPIHN 53
           +L A+NRW +TGTP  N
Sbjct: 785 SLVASNRWILTGTPTPN 801


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,856,335
Number of Sequences: 37544
Number of extensions: 416647
Number of successful extensions: 1263
Number of sequences better than 10.0: 44
Number of HSP's better than 10.0 without gapping: 1183
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1252
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2127163404
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -