SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613,287...    32   0.54 
01_05_0653 - 23948911-23948937,23949031-23949141,23949361-239494...    31   0.71 
01_05_0652 - 23934604-23934636,23934783-23934893,23935000-239351...    31   0.71 
07_03_1022 - 23353054-23353263,23353399-23353505,23354613-23354961     31   1.2  
08_02_0644 - 19658270-19658626,19659142-19659218,19659256-196594...    30   2.2  
01_01_0489 + 3608720-3608811,3609326-3609431,3609518-3609581,360...    30   2.2  
04_04_1126 + 31095651-31096115                                         29   2.9  
12_01_0249 + 1850443-1851030                                           29   3.8  
05_05_0382 + 24547680-24548760,24548887-24549033,24549389-24550023     29   3.8  
05_03_0069 + 8004235-8004350,8004927-8005215,8005314-8005375,800...    29   3.8  
05_01_0251 + 1901709-1901864,1901968-1901999,1902534-1902664,190...    29   3.8  
04_04_1393 - 33204699-33204806,33204927-33205164,33205581-332058...    29   3.8  
02_04_0005 - 18843061-18843201,18843309-18843440,18844457-188453...    29   5.0  
12_01_1068 - 11052769-11052943,11053103-11053182,11053304-110534...    28   6.6  
03_02_0834 - 11630288-11630500,11630531-11630623,11630844-116310...    28   6.6  
02_04_0517 - 23599154-23600089                                         28   6.6  
07_03_1544 - 27585581-27585757,27585986-27586091,27586246-275863...    28   8.8  

>05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613,
            2879715-2879973,2880060-2880346,2880423-2880758,
            2880862-2881003,2881077-2881297,2881379-2881540,
            2881617-2881775,2881860-2882159,2882834-2883097,
            2883133-2883243,2883902-2883988
          Length = 1871

 Score = 31.9 bits (69), Expect = 0.54
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = +1

Query: 31   YNTPPPPLRY-PSNPATAIFTNAQTYN-NAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYN 204
            YN   P   Y P++P+ +  + + +Y+  +P Y P +   N   TS S S  S + +P +
Sbjct: 1697 YNPTSPSYSYSPTSPSYSPTSPSYSYSPTSPSYSPTSPSYNYSPTSPSYSPTSPSYSPTS 1756

Query: 205  KSKEPT 222
             S  PT
Sbjct: 1757 PSYSPT 1762



 Score = 28.7 bits (61), Expect = 5.0
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 1/66 (1%)
 Frame = +1

Query: 28   YYNTPPPPLRYPSNPATAIFTNAQTYN-NAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYN 204
            Y  +P  P   P++P+ +    + +Y+  +P Y    T  +   TS S S  S + +P +
Sbjct: 1704 YSYSPTSPSYSPTSPSYSYSPTSPSYSPTSPSYNYSPTSPSYSPTSPSYSPTSPSYSPTS 1763

Query: 205  KSKEPT 222
             S  PT
Sbjct: 1764 PSYSPT 1769


>01_05_0653 -
           23948911-23948937,23949031-23949141,23949361-23949441,
           23949865-23949984,23950088-23950252,23950344-23950493,
           23950565-23950674,23951401-23951518,23951597-23951827,
           23952345-23952524,23953639-23953908,23954930-23954979,
           23955213-23955288,23955396-23955483,23956010-23956101,
           23956200-23956529,23957484-23957593,23957810-23957907,
           23959538-23959566
          Length = 811

 Score = 31.5 bits (68), Expect = 0.71
 Identities = 15/37 (40%), Positives = 20/37 (54%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSD 191
           H HQ+  +QQ    RAA   +QQ   + QQQ +L  D
Sbjct: 100 HQHQQIQMQQMLLQRAAQQQQQQQQQQQQQQQQLHRD 136


>01_05_0652 -
           23934604-23934636,23934783-23934893,23935000-23935188,
           23935893-23936012,23936109-23936273,23936638-23936790,
           23936867-23936976,23937280-23937397,23938197-23938427,
           23938984-23939175,23939661-23939945,23940637-23940686,
           23940846-23940921,23941048-23941135,23941689-23941771,
           23941883-23942248,23942462-23942476,23942909-23943018,
           23943134-23943231,23943961-23944019
          Length = 883

 Score = 31.5 bits (68), Expect = 0.71
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +3

Query: 90  QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTD 221
           Q   +QQ    RAA   +QQ   + QQQ +    +  QQ+QR D
Sbjct: 120 QHIQMQQMLLQRAAQQQQQQQQQQQQQQQQQQQQQQQQQQQRRD 163


>07_03_1022 - 23353054-23353263,23353399-23353505,23354613-23354961
          Length = 221

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +1

Query: 40  PPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDT 159
           PPPP   P +P  A+F +A+    +P    P+TR  ++ T
Sbjct: 5   PPPPSAPPPSPPRAVFPSARCCLPSPHRFLPSTRRKRLVT 44


>08_02_0644 -
           19658270-19658626,19659142-19659218,19659256-19659430,
           19659543-19659596,19659691-19659858,19660756-19660953,
           19661546-19661632,19661739-19661827,19662499-19662955
          Length = 553

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 3/72 (4%)
 Frame = +3

Query: 30  LQHPSAAAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQE 209
           L  P AAA  SL         +     R R+++   AR++  +    + + G D +V +E
Sbjct: 7   LSFPVAAASKSLSFPAAAQSNKGTPAARKRIKSGGGAREKKENSGGAREEQGKDDSVGEE 66

Query: 210 Q---RTDARRRR 236
           Q   R D RRRR
Sbjct: 67  QVQRRRDGRRRR 78


>01_01_0489 +
           3608720-3608811,3609326-3609431,3609518-3609581,
           3609905-3609965,3610017-3610144,3610236-3610385,
           3610537-3610791,3611060-3611265,3611469-3611696,
           3612161-3612259
          Length = 462

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 18/66 (27%), Positives = 34/66 (51%)
 Frame = -1

Query: 473 LGRVALSQLFLQPNQVAYHGLLRFKPLYHVYVDRVRVDAHVTNSVYKMNHERTKF*HVIA 294
           +GR+        P+  A  GLLR  P++ V++D VRV    +  +Y++ +   K+   ++
Sbjct: 247 VGRLVKGSSKPHPSLPARGGLLRTAPVHEVHLDLVRVS---SGKIYRLRNPSRKYLASLS 303

Query: 293 PVISNN 276
              S+N
Sbjct: 304 SYDSSN 309


>04_04_1126 + 31095651-31096115
          Length = 154

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 14/37 (37%), Positives = 16/37 (43%)
 Frame = -1

Query: 653 CCTSPIPPPCTGRPS*VVCPPRPKRLYPTYQRHRCKI 543
           C T   PPP    PS V CPP P    P     +C +
Sbjct: 36  CPTPKPPPPPPPAPSGVPCPPPPYTPTPATPTGKCPV 72


>12_01_0249 + 1850443-1851030
          Length = 195

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 13/39 (33%), Positives = 21/39 (53%)
 Frame = -3

Query: 540 CAYAGSEFSTKMPEIYSNRSAGTRPRCLVPTLFATESGG 424
           C++  +  S+ +    S+ SA T PR ++PT  A  S G
Sbjct: 35  CSFGSTTSSSSLAASSSDDSAATTPRSVLPTSAAASSSG 73


>05_05_0382 + 24547680-24548760,24548887-24549033,24549389-24550023
          Length = 620

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 19/62 (30%), Positives = 26/62 (41%)
 Frame = +3

Query: 30  LQHPSAAAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQE 209
           L   SA A V+L S   H H RA     A        + +N   P      G+DR+ + E
Sbjct: 540 LPRRSACASVALKSSGCHHHVRAGAAAAAHGSVRTSRQSRNNAPPMAPTIRGADRSSEGE 599

Query: 210 QR 215
           +R
Sbjct: 600 RR 601


>05_03_0069 +
           8004235-8004350,8004927-8005215,8005314-8005375,
           8005516-8005602,8005667-8005723,8005940-8006004,
           8006292-8006320
          Length = 234

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 18/60 (30%), Positives = 27/60 (45%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPT 222
           PPP  +  NP+T I     +  + P   P  +  +K  T +++ST   AI     S E T
Sbjct: 146 PPPAPHTDNPSTTIHNTGASSKSTP---PEISLADKTPTEKTSSTRKRAIDFTKDSIEET 202


>05_01_0251 +
           1901709-1901864,1901968-1901999,1902534-1902664,
           1902740-1902821,1902928-1903054,1903369-1903686,
           1903785-1903846,1903988-1904074,1904139-1904195,
           1906113-1906197,1906916-1907185,1908158-1908254,
           1908390-1908436,1908826-1908939,1909024-1909117,
           1909360-1909457,1910356-1910455,1911445-1911521,
           1911824-1913122
          Length = 1110

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 18/60 (30%), Positives = 27/60 (45%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEPT 222
           PPP  +  NP+T I     +  + P   P  +  +K  T +++ST   AI     S E T
Sbjct: 293 PPPAPHTDNPSTTIHNTGASSKSTP---PEISLADKTPTEKTSSTTKRAIDFTKDSIEET 349


>04_04_1393 -
           33204699-33204806,33204927-33205164,33205581-33205825,
           33206229-33206339,33206645-33206743,33207684-33207731,
           33207882-33207999,33208085-33208115,33208700-33208806,
           33209644-33209725,33210010-33210104,33210579-33210664,
           33211074-33211195,33211613-33211824,33212362-33212510,
           33212755-33212982
          Length = 692

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 11/28 (39%), Positives = 20/28 (71%)
 Frame = +3

Query: 273 KIIRYYRCNDMSELSPLMIHFINTIRDM 356
           KII  Y+ N+++++S L  HFI+ + D+
Sbjct: 599 KIIESYKSNNVNQVSNLCQHFIDLVNDL 626


>02_04_0005 -
           18843061-18843201,18843309-18843440,18844457-18845315,
           18845884-18845973,18846748-18846869,18846950-18847049,
           18847151-18847205,18847275-18847365,18847453-18847572,
           18847681-18847780,18847890-18848018,18848099-18848201,
           18848670-18848743,18848848-18848933,18849297-18849358,
           18849454-18849541,18849937-18850029
          Length = 814

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 15/49 (30%), Positives = 22/49 (44%)
 Frame = +1

Query: 16  RGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTS 162
           +G+  Y  PPPP   P     A+F    +      Y PPT R+  ++ S
Sbjct: 665 KGSTCYPPPPPPSSTPPVEPVAVFPPPPSPACGVYYPPPTVREPVINRS 713


>12_01_1068 -
           11052769-11052943,11053103-11053182,11053304-11053401,
           11053487-11053627,11053701-11053841,11053933-11054017,
           11055296-11055826,11055926-11055940
          Length = 421

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 2/72 (2%)
 Frame = +1

Query: 31  YNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPY--N 204
           ++ PPP   Y +  A   ++++ +Y       PP   D  + +S S    +VA AP    
Sbjct: 77  WDPPPPSSPYSAGHAADEYSSSSSYRRRGASAPP-AEDVVVSSSYSRPAAAVASAPQACT 135

Query: 205 KSKEPTLDAGES 240
            S  P L A E+
Sbjct: 136 VSSAPPLRAVET 147


>03_02_0834 -
           11630288-11630500,11630531-11630623,11630844-11631050,
           11631301-11633089,11633817-11634145
          Length = 876

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 9/16 (56%), Positives = 13/16 (81%)
 Frame = -1

Query: 620 GRPS*VVCPPRPKRLY 573
           GRPS ++C PRP +L+
Sbjct: 858 GRPSDIICSPRPSKLF 873


>02_04_0517 - 23599154-23600089
          Length = 311

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +3

Query: 156 HEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVD 263
           +E + Q  L    T++QE++   R RR YL  +C D
Sbjct: 4   NEEKAQSMLNRFITMKQEEKRKPRERRPYLASECRD 39


>07_03_1544 -
           27585581-27585757,27585986-27586091,27586246-27586338,
           27587840-27587958,27588486-27588746,27589226-27589515,
           27589624-27590152
          Length = 524

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +1

Query: 613 GRPVHGGGIGDVQHSHSVTVQSAAGQQLHDSVAQA 717
           G P    G+G  Q++  VTV +AAG+ L   +A+A
Sbjct: 88  GLPGQPAGVGFAQYAGYVTVDAAAGRALFYYLAEA 122


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,718,574
Number of Sequences: 37544
Number of extensions: 470586
Number of successful extensions: 2052
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1845
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2028
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1921741964
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -