SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0775 - 7531397-7531564,7531590-7532771                           67   1e-11
10_02_0059 + 4785858-4786988                                           66   3e-11
03_02_1029 - 13488535-13493037                                         66   3e-11
09_04_0061 - 14256767-14256845,14256862-14257224,14260846-14261555     65   6e-11
09_02_0555 - 10588685-10592038                                         65   6e-11
08_02_0167 - 13564466-13566227,13566361-13566644,13566684-135675...    64   1e-10
05_03_0317 - 12249228-12249275,12263876-12264518,12264954-122666...    64   1e-10
08_01_0147 - 1166439-1166460,1166525-1167537                           64   1e-10
08_01_0441 + 3890231-3890845,3891253-3894220,3906625-3906713,390...    62   3e-10
07_03_1512 + 27288779-27289222,27298101-27298399,27298499-272985...    62   5e-10
09_01_0103 - 1628763-1628879,1641827-1642921,1645126-1645476,164...    60   2e-09
04_01_0187 - 2153546-2154520,2154581-2155858                           59   4e-09
06_03_1250 + 28709429-28710208                                         57   1e-08
09_06_0375 - 22653366-22657112,22657185-22658457,22658833-22659539     54   1e-07
06_02_0121 + 12080417-12081632,12082428-12082780,12082844-12083776     54   1e-07
05_03_0669 + 16802158-16802495,16802574-16803906,16803970-16804818     54   1e-07
04_04_0645 + 26913947-26915783,26915833-26916308,26916372-26917220     54   1e-07
03_02_0330 + 7502593-7504956,7505020-7506312,7522011-7522235           54   1e-07
02_03_0116 - 15440263-15441024,15441097-15443451                       54   1e-07
04_04_1405 - 33305948-33309676,33309749-33310468,33310533-333114...    54   1e-07
04_04_1081 - 30700791-30700904,30701011-30703053,30703126-30704376     54   1e-07
01_06_1164 - 35026345-35026954,35027853-35027939,35028120-350284...    54   1e-07
01_05_0016 + 17177812-17178084,17178358-17178480,17178526-171788...    54   1e-07
10_08_0584 + 18971761-18971834,18971852-18973133,18973197-189745...    53   2e-07
12_02_0065 - 13109652-13110746,13110843-13111762,13139462-131395...    52   6e-07
08_02_0107 + 12494650-12495270,12507463-12508146,12508325-125084...    52   6e-07
11_01_0792 + 6679002-6679603,6738490-6738520,6738532-6739644           51   7e-07
04_01_0293 + 3881375-3883698,3906619-3907636,3907820-3908309,391...    51   7e-07
04_01_0123 - 1283197-1283292,1283330-1284439,1284790-1285177,128...    51   7e-07
10_02_0167 - 6100676-6102111,6102174-6102708,6102967-6103975,610...    51   1e-06
09_02_0521 + 10162396-10162587,10162687-10163679                       51   1e-06
07_03_0508 - 18892193-18893119,18893183-18894528,18894594-18895206     51   1e-06
01_06_0717 - 31446860-31447074,31447183-31447270,31448909-314490...    51   1e-06
01_05_0590 + 23480381-23481169                                         51   1e-06
10_05_0026 + 8262237-8262899,8263300-8263509,8263599-8265480,826...    50   1e-06
03_05_0527 + 25220375-25221425,25221513-25222182,25222347-252224...    50   2e-06
03_02_1026 + 13313672-13313876,13341211-13342005,13363815-133638...    50   2e-06
02_03_0347 - 17999780-18000592,18000656-18003019                       49   4e-06
05_03_0294 + 11818391-11820268,11820332-11820550,11820752-118216...    47   2e-05
05_03_0195 - 9560885-9561435,9561553-9561639,9562199-9563225           46   2e-05
10_04_0010 - 7487455-7489490,7489569-7489980                           46   3e-05
02_02_0305 + 8786599-8787184,8788613-8790001,8790370-8791196           44   9e-05
07_03_1435 - 26532302-26533159,26533559-26534902,26535180-26535188     44   1e-04
01_01_0100 - 755894-756662,757086-757598,758718-761050                 42   3e-04
04_03_0647 + 18367321-18367675,18368044-18368885                       36   0.023
11_03_0064 + 9518810-9519164,9519533-9520359                           36   0.030
10_07_0179 - 13860745-13861571,13861940-13862294                       36   0.030
08_02_1451 - 27192418-27192423,27192424-27193146                       36   0.030
09_01_0073 - 1057560-1058043,1058199-1058385,1058754-1059062,105...    36   0.039
05_04_0184 - 18855062-18855604,18855889-18856611                       36   0.039
01_01_0676 + 5194718-5194940,5195420-5195952                           36   0.039
07_01_1218 - 11633829-11634628,11634713-11635050,11635349-116354...    35   0.069
05_04_0308 - 20081366-20082404,20082702-20083078,20084293-200846...    35   0.069
02_02_0538 - 11311171-11311596,11312507-11312581                       35   0.069
10_05_0085 - 9005539-9005922,9006207-9006463,9006707-9006883,900...    34   0.12 
12_02_0356 + 17915029-17916236,17932970-17933283,17933936-179342...    33   0.28 
04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305,962...    33   0.28 
12_02_1003 - 25183468-25184010,25184295-25184551,25184795-251849...    32   0.37 
04_04_0893 - 29152150-29153156,29153234-29153561,29153645-291538...    31   0.64 
10_01_0086 - 1064650-1065379,1065796-1065950,1066029-1066141,106...    30   1.5  
12_02_0189 + 15165485-15168694                                         30   2.0  
10_08_0262 + 16307003-16308416,16309501-16309595,16309954-163099...    29   2.6  
10_07_0031 + 12051846-12052059,12052360-12052410,12053514-120535...    29   3.4  
02_02_0597 - 11996350-11996483,11997511-11997604,11997877-119980...    29   4.5  
08_02_0362 - 16230672-16230994,16231120-16231164,16231999-162320...    28   6.0  
07_03_0064 + 12995669-12995904,12996299-12996533,12998223-129983...    28   6.0  
10_07_0032 + 12096290-12097042,12097056-12098066,12110194-12110454     28   7.9  
05_04_0035 + 17378541-17381276                                         28   7.9  

>08_01_0775 - 7531397-7531564,7531590-7532771
          Length = 449

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 31/86 (36%), Positives = 49/86 (56%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + ++ +    +KC F   EV FLG+ ISA G     E + A+ D+  P+TV  +RRF+G+
Sbjct: 36  LREHQLYAKLSKCEFWLSEVKFLGHVISAKGVAVDPEIVTAVTDWKQPKTVTQVRRFLGL 95

Query: 433 VNYYRRFLRNAAKLQAPLVNAIVATE 510
             YYRRF+ N +K+  P+   +   E
Sbjct: 96  AGYYRRFIENFSKIAQPMTQLLKKEE 121



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 13/31 (41%), Positives = 19/31 (61%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   ++DDILVYS+    H  HLR +  +L+
Sbjct: 7   FVVVFIDDILVYSQSEKDHQQHLRLVLGKLR 37



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/43 (30%), Positives = 23/43 (53%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           WTP+ E+ F   K+ L S+ ++  P    +  ++ DAS   +G
Sbjct: 125 WTPQCEKTFQTLKEKLVSSPVLILPDTRKDFLVYCDASRQGLG 167


>10_02_0059 + 4785858-4786988
          Length = 376

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 30/86 (34%), Positives = 48/86 (55%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + ++ +    +KC F   EV FLG+ ISA G     E + A+ D+  P+TV  +R F+G+
Sbjct: 170 LREHQLYAKLSKCEFWLSEVKFLGHVISAKGVAVDPETVTAVTDWKQPKTVTQIRSFLGL 229

Query: 433 VNYYRRFLRNAAKLQAPLVNAIVATE 510
             YYRRF+ N +K+  P+   +   E
Sbjct: 230 AGYYRRFIENFSKIARPMTQLLKKEE 255



 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 23/51 (45%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +G+YEF  M+FGL NA   F   +++
Sbjct: 82  IDLRSGYHQLRIREEDIPKTAFTTRYGVYEFTVMSFGLTNAPAFFMNLMNK 132



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YS+    H  HLR +  +L+
Sbjct: 130 MNKVFMEYLDKFVVVFIDDILIYSQSEEDHQHHLRLVLGKLR 171



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           W+P+ E+ F   K+ L S+ ++  P    +  ++ DAS   +G
Sbjct: 259 WSPQCEKAFQTLKEKLVSSPVLILPDTRKDFVVYCDASRQGLG 301


>03_02_1029 - 13488535-13493037
          Length = 1500

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 30/86 (34%), Positives = 48/86 (55%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + ++ +    +KC F   EV FLG+ ISA G     E + A+ D+  P+TV  +R F+G+
Sbjct: 740 LREHQLYAKLSKCEFWLSEVKFLGHVISAKGVAVDPETVTAVTDWKQPKTVTQIRSFLGL 799

Query: 433 VNYYRRFLRNAAKLQAPLVNAIVATE 510
             YYRRF+ N +K+  P+   +   E
Sbjct: 800 AGYYRRFIENFSKIARPMTQLLKKEE 825



 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 652 IDLRSGYHQLRIREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 702



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YS+    H  HLR +  +L+
Sbjct: 700 MNKVFMEYLDKFVVVFIDDILIYSQSEEDHQHHLRLVLGKLR 741



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           W+P+ E+ F   K+ L S+ ++  P    +  ++ DAS   +G
Sbjct: 829 WSPQCEKAFQTLKEKLVSSPVLILPDTRKDFMVYCDASRQGLG 871


>09_04_0061 - 14256767-14256845,14256862-14257224,14260846-14261555
          Length = 383

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 30/75 (40%), Positives = 43/75 (57%)
 Frame = +1

Query: 286 KCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNA 465
           KC F   EV FLG+ ISA G     E + A+ D+  P+TV  +R F+G+  YYRRF+ N 
Sbjct: 238 KCEFWLSEVKFLGHVISAKGVAVDPETVTAVTDWKQPKTVTQIRSFLGLAGYYRRFIENF 297

Query: 466 AKLQAPLVNAIVATE 510
           +K+  P+   +   E
Sbjct: 298 SKIARPMTQLLKKEE 312



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGL 89
           IDL   Y Q+ +  EDI KTA  T +GL
Sbjct: 210 IDLRSGYHQLRIREEDIPKTAFTTRYGL 237



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           W+P+ E+ F   K+ L S+ ++  P    +  ++ DAS   +G
Sbjct: 316 WSPQCEKAFQTLKEKLVSSPVLILPDTRKDFMVYCDASRQGLG 358


>09_02_0555 - 10588685-10592038
          Length = 1117

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 30/86 (34%), Positives = 47/86 (54%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + ++ +    +KC F   EV FLG+ ISA G     E   A+ D+  P+TV  +R F+G+
Sbjct: 357 LREHQLYAKLSKCEFWLSEVKFLGHMISAKGVAVDPETATAVTDWKQPKTVTQIRSFLGL 416

Query: 433 VNYYRRFLRNAAKLQAPLVNAIVATE 510
             YYRRF+ N +K+  P+   +   E
Sbjct: 417 AGYYRRFIENFSKIARPMTQLLKKEE 442



 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 269 IDLRSGYHQLRIREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 319



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YS+    H  HLR +  +L+
Sbjct: 317 MNKVFMEYLDKFVVVFIDDILIYSQSEEDHQHHLRLVLGKLR 358



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/43 (27%), Positives = 24/43 (55%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           W+P+ E+ F   K+ L S+ ++  P  + +  ++ DAS   +G
Sbjct: 446 WSPQCEKAFQTLKEKLVSSPVLILPDTHKDFMVYCDASRQGLG 488


>08_02_0167 -
           13564466-13566227,13566361-13566644,13566684-13567540,
           13567684-13567957,13567973-13568218
          Length = 1140

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 29/76 (38%), Positives = 44/76 (57%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F   EV FLG+ ISA G     E + A+ D   P++V  +R F+G+  YYRRF++N
Sbjct: 461 SKCEFWLSEVKFLGHVISAKGVAVDPETVTAVTDLKQPKSVTQVRSFLGLAGYYRRFIKN 520

Query: 463 AAKLQAPLVNAIVATE 510
            +K+  P+   +   E
Sbjct: 521 FSKISRPMTQLLKKEE 536



 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 376 IDLRSGYHQLRIREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 426



 Score = 34.3 bits (75), Expect = 0.091
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFK 250
           ++K++    D F   ++DDILVYS+    H  HLR L K
Sbjct: 424 MNKVFMEYLDKFVVVFIDDILVYSQSEEDHQQHLRLLSK 462


>05_03_0317 -
           12249228-12249275,12263876-12264518,12264954-12266682,
           12283603-12283975,12284119-12284715
          Length = 1129

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 29/85 (34%), Positives = 51/85 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F A+ D  +  N  KC F    V FLG  ++  G +    +++A++ +P P+TV  +R F
Sbjct: 559 FNALRDARLFGNLEKCTFCIDRVPFLGYVVTPQGIEVDQAKVEAIQSWPTPKTVSQVRSF 618

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+  +YRRF+++ + + APL NA+
Sbjct: 619 LGLAGFYRRFVQDFSTIAAPL-NAL 642



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 25/51 (49%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL   Y QI +   D  KTA  T FGLYE+  M FGL NA  TF R ++E
Sbjct: 474 VDLRSGYHQIRMKLGDEWKTAFKTKFGLYEWLVMPFGLTNAPSTFMRLMNE 524



 Score = 34.7 bits (76), Expect = 0.069
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   Y DDIL+YS+   +H  HLR +F  L+
Sbjct: 533 FVVVYFDDILIYSKSMGEHFNHLRAVFNALR 563



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 19/50 (38%), Positives = 24/50 (48%)
 Frame = +3

Query: 513 KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           KG+ P TW    E  F+  KD L+ A L+  P  N    L  DAS   +G
Sbjct: 645 KGV-PFTWGTSQENAFHMLKDKLTHAPLLQLPDFNKTFELECDASGIGLG 693


>08_01_0147 - 1166439-1166460,1166525-1167537
          Length = 344

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 28/85 (32%), Positives = 51/85 (60%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  + D  +  N  KC F    V+FLG  ++  G +    +++A++ +P P+TV  +R F
Sbjct: 53  FNVLRDARLFGNLEKCTFCTDRVSFLGYVVTPQGIEVDQAKVEAIQSWPTPKTVSQVRSF 112

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAI 498
           +G+  +YRRF+++ + + APL NA+
Sbjct: 113 LGLAGFYRRFVQDFSTIAAPL-NAL 136



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 167 FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           F   Y DDIL+YS+   +H  HLR +F  L+
Sbjct: 27  FVVVYFDDILIYSKSMGEHFNHLRAVFNVLR 57



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 19/50 (38%), Positives = 24/50 (48%)
 Frame = +3

Query: 513 KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           KG+ P TW    E  F+  KD L+ A L+  P  N    L  DAS   +G
Sbjct: 139 KGV-PFTWGTSQENAFHMLKDKLTHAPLLQLPDFNKTFELECDASGIGLG 187


>08_01_0441 + 3890231-3890845,3891253-3894220,3906625-3906713,
            3908317-3908337
          Length = 1230

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 26/86 (30%), Positives = 49/86 (56%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +R 
Sbjct: 927  ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWKQPKTVSEIRS 986

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAI 498
            F+G+  YYRRF+ N +K+  P+   +
Sbjct: 987  FLGLAGYYRRFIENFSKIAKPMTRLL 1012



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 843 IDLRSGYHQLRIKEEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 893



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137  VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            ++K++    D F   ++DDIL+YSR   +H  HLR   ++L+
Sbjct: 891  MNKVFMEYLDKFVAVFIDDILIYSRTKEEHEEHLRLALEKLR 932


>07_03_1512 + 27288779-27289222,27298101-27298399,27298499-27298589,
            27298701-27298766,27299151-27302660,27311604-27312224
          Length = 1676

 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 28/92 (30%), Positives = 52/92 (56%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            + + + ++ +    +KC F   EV FLG+ IS+ G       ++++  +  P+TV  +R 
Sbjct: 1013 ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISSGGVAVDPSNVESVLSWKQPKTVSEIRS 1072

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAIVATEVK 516
            F+G+  YYRRF+ N +K+  P+   ++  EVK
Sbjct: 1073 FLGLAGYYRRFIENFSKIARPMTR-LLQKEVK 1103



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            IDL   Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 929  IDLRSGYHQLRIREEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 979



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 14/42 (33%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137  VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            ++K++    D F   ++DDIL+YS+   +H  HLR   ++L+
Sbjct: 977  MNKVFMEYLDKFVVVFIDDILIYSKTKEEHEEHLRLALEKLR 1018


>09_01_0103 -
           1628763-1628879,1641827-1642921,1645126-1645476,
           1645567-1645734
          Length = 576

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 25/78 (32%), Positives = 47/78 (60%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + + ++++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +R 
Sbjct: 395 ALEKLQEHQLYAKFSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWKQPKTVSEIRS 454

Query: 421 FIGMVNYYRRFLRNAAKL 474
           F+G+  YYRRF+ N +K+
Sbjct: 455 FLGLAGYYRRFIENFSKI 472



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 22/51 (43%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL+  Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 311 IDLLSGYHQLRIKEEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 361



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YSR   +H  HLR   ++L+
Sbjct: 359 MNKVFMEYLDKFVVVFIDDILIYSRTKEEHEEHLRLALEKLQ 400


>04_01_0187 - 2153546-2154520,2154581-2155858
          Length = 750

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 26/72 (36%), Positives = 41/72 (56%)
 Frame = +1

Query: 283 AKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRN 462
           +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +R F+G   YYRRF+ N
Sbjct: 66  SKCEFWLSEVKFLGHIISAGGVAVDPSNVESVTNWKQPKTVSEIRSFLGFTGYYRRFIDN 125

Query: 463 AAKLQAPLVNAI 498
             K+  P+   +
Sbjct: 126 FFKIAKPMTRLL 137



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YSR   +H  HLR   ++L+
Sbjct: 16  MNKVFMEYLDKFVVVFIDDILIYSRTKEEHEEHLRLALEKLR 57


>06_03_1250 + 28709429-28710208
          Length = 259

 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+    YG+ +NP KC FG     FLG  +   G + P   I A+K    P     L+  
Sbjct: 166 FERTRKYGLKMNPTKCAFGVSAGQFLGFLVHERGIEIPQRSINAIKKIKPPGNKTELQEM 225

Query: 424 IGMVNYYRRFLRN-AAKLQ 477
           IG +N+ RRF+ N + KL+
Sbjct: 226 IGKINFVRRFISNLSGKLE 244



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (4%)
 Frame = +3

Query: 24  YQQIPVAPEDICKTAIITP--FGLYEFNYMTFGLRNAGQTFQR 146
           Y QI +A EDI KTA   P   GL+E+  MTFG ++AG T+QR
Sbjct: 85  YNQIFMAEEDIHKTAFRYPGAIGLFEWVVMTFGSKSAGATYQR 127


>09_06_0375 - 22653366-22657112,22657185-22658457,22658833-22659539
          Length = 1908

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +A ED  KTA ITP G Y +  M FGL+NAG TFQR
Sbjct: 792 LDAYSGYHQIRMAREDEEKTAFITPIGTYCYTTMPFGLKNAGPTFQR 838



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            +F+++    I +NP KCVFG P    LG  +SA G +   E+I+A++    P  ++ ++ 
Sbjct: 876  TFESLRSARIKLNPDKCVFGVPAGKLLGFLVSARGIEANPEKIRAIERMRPPSKLRDVQC 935

Query: 421  FIGMVNYYRRFLRNAAKLQAPL 486
              G +    RF+    +   PL
Sbjct: 936  VTGCMAALSRFISRLGEKALPL 957



 Score = 31.5 bits (68), Expect = 0.64
 Identities = 17/47 (36%), Positives = 22/47 (46%)
 Frame = +3

Query: 525  PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            P TWT E E      K  LSS  ++  P P+  L L+  A+   V A
Sbjct: 966  PFTWTEEAENALTQLKAYLSSPPVLVAPEPDEPLLLYLAATPQVVSA 1012


>06_02_0121 + 12080417-12081632,12082428-12082780,12082844-12083776
          Length = 833

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +A ED  KTA ITP G Y +  M FGL+NAG TFQR
Sbjct: 655 LDAYSGYHQIRMAREDEEKTAFITPIGTYCYTTMPFGLKNAGPTFQR 701



 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 24/82 (29%), Positives = 41/82 (50%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F+++    I +NP KCVFG P    LG  I A G +   E+I+A++    P  ++ ++ 
Sbjct: 739 TFESLRTARIKLNPDKCVFGVPAGKLLGFLIFARGIEANPEKIRAIERMRPPSKLRDVQC 798

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
             G +    RF+    +   PL
Sbjct: 799 VTGCMAALSRFISRLGEKALPL 820


>05_03_0669 + 16802158-16802495,16802574-16803906,16803970-16804818
          Length = 839

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +A ED  KTA ITP G Y +  M FGL+NAG TFQR
Sbjct: 689 LDAYSGYHQIRMAREDEEKTAFITPIGTYCYTTMPFGLKNAGPTFQR 735



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/55 (36%), Positives = 32/55 (58%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTV 405
           +F+++    I +NP KCVFG P    LG  ISA G +   E+I+A++    P ++
Sbjct: 773 TFESLRTARIKLNPDKCVFGVPVGKLLGFLISARGIEANPEKIRAIERMRPPASL 827


>04_04_0645 + 26913947-26915783,26915833-26916308,26916372-26917220
          Length = 1053

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
            +D    Y QI +A ED  KTA ITP G Y +  M FGL+NAG TFQR
Sbjct: 903  LDAYSGYHQIRMAREDEEKTAFITPIGTYCYTTMPFGLKNAGPTFQR 949



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTV 405
            +F+++    I +NP KCVFG P    LG  +SA G +   E+I+A++    P ++
Sbjct: 987  TFESLRTARIKLNPDKCVFGVPAGMLLGFLVSARGIEANPEKIRAIERMRPPASL 1041


>03_02_0330 + 7502593-7504956,7505020-7506312,7522011-7522235
          Length = 1293

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
            +D    Y QI +A ED  KTA ITP G Y +  M FGL+NAG TFQR
Sbjct: 920  LDAYSGYHQIRMAREDEEKTAFITPIGTYCYTTMPFGLKNAGPTFQR 966



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 29/117 (24%), Positives = 56/117 (47%), Gaps = 4/117 (3%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            +F+++    I +NP KCVFG P    LG  +SA G +   E+++A++    P  ++ ++ 
Sbjct: 1004 TFESLRTARIKLNPDKCVFGVPAGKLLGFLVSARGIEANPEKLRAIERMRPPSKLRDVQC 1063

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAIVATE----VKVSHRSLGHLSSKNALMPVKIA 579
              G +    RF+    +   PL   +  +      + + R+L  L +  +  PV +A
Sbjct: 1064 VTGCMAALSRFISRLGEKALPLFKLLKCSGPFIWTEEAERALTQLKAYLSSPPVLVA 1120


>02_03_0116 - 15440263-15441024,15441097-15443451
          Length = 1038

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
            +D    Y QI +A ED  KTA ITP G Y +  M FGL+NAG TFQR
Sbjct: 917  LDAYSGYHQIRMAREDEEKTAFITPIGTYCYTTMPFGLKNAGPTFQR 963


>04_04_1405 -
           33305948-33309676,33309749-33310468,33310533-33311439,
           33334405-33334484
          Length = 1811

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +A ED  KTA ITP G Y +  M FGL+NAG TFQR
Sbjct: 701 LDAYSGYHQIRMAREDEEKTAFITPVGTYCYTSMPFGLKNAGPTFQR 747



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 24/82 (29%), Positives = 41/82 (50%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            +F+ +    I +NP KCVFG P    LG  +SA G +   E+I+A++    P  ++ ++ 
Sbjct: 785  TFENLRSARIKLNPDKCVFGVPAGKLLGFLVSARGIEANPEKIRAIERMRPPSKLRDVQC 844

Query: 421  FIGMVNYYRRFLRNAAKLQAPL 486
              G +    RF+    +   PL
Sbjct: 845  VTGCMAALSRFISRLGEKALPL 866



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 18/47 (38%), Positives = 22/47 (46%)
 Frame = +3

Query: 525  PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            P TWT E E      K  LSS  ++  P PN  L L+  A+   V A
Sbjct: 875  PFTWTEEAEHALTQLKAYLSSPPVLVAPEPNEPLLLYLAATPQVVSA 921


>04_04_1081 - 30700791-30700904,30701011-30703053,30703126-30704376
          Length = 1135

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +A ED  KTA ITP G Y +  M FGL+NAG TFQR
Sbjct: 549 LDAYSGYHQIRMAREDEEKTAFITPVGTYCYTSMPFGLKNAGPTFQR 595



 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 4/116 (3%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +    I +NP KCVFG P    LG  +SA G +   E+I+A++    P  ++ ++  
Sbjct: 634 FENLRSARIKLNPDKCVFGVPAGKLLGFLVSARGIEANPEKIRAIERMRPPSKLRDVQCV 693

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVA----TEVKVSHRSLGHLSSKNALMPVKIA 579
            G +    RF+    +   PL   +      T  + + R+L  L +  +  PV +A
Sbjct: 694 TGCIAALSRFISRLGEKALPLFKLLKRSGPFTWTEEAERALTQLKAYLSSPPVLVA 749



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 18/47 (38%), Positives = 22/47 (46%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           P TWT E E      K  LSS  ++  P PN  L L+  A+   V A
Sbjct: 723 PFTWTEEAERALTQLKAYLSSPPVLVAPGPNEPLLLYLAATPQVVSA 769


>01_06_1164 - 35026345-35026954,35027853-35027939,35028120-35028493,
            35037372-35038586,35038659-35039316,35039331-35041012
          Length = 1541

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
            +D    Y QI +A ED  KTA ITP G Y +  M FGL+NAG TFQR
Sbjct: 912  LDAYSGYHQICMAREDEEKTAFITPIGTYCYTTMPFGLKNAGPTFQR 958



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 23/82 (28%), Positives = 42/82 (51%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            +F+++    I +NP KCVFG P    LG  +SA G +   E+++A++    P  ++ ++ 
Sbjct: 996  TFESLRTARIKLNPDKCVFGVPAGKLLGFLVSARGIEANPEKVRAIERMRPPSKLRDVQC 1055

Query: 421  FIGMVNYYRRFLRNAAKLQAPL 486
              G +    RF+    +   PL
Sbjct: 1056 VTGCMAALSRFISRLGEKALPL 1077



 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/47 (34%), Positives = 21/47 (44%)
 Frame = +3

Query: 525  PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            P  WT E E      K  LSS  ++  P P+  L L+  A+   V A
Sbjct: 1086 PFIWTEEAERALTQLKAYLSSPPVLVAPEPDEPLLLYLAATPQVVSA 1132


>01_05_0016 +
           17177812-17178084,17178358-17178480,17178526-17178862,
           17178896-17179039,17179555-17180219
          Length = 513

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 25/80 (31%), Positives = 38/80 (47%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+    YG+ +NP KC FG     FLG  +   G +     I A+K    P+    L+  
Sbjct: 430 FERTRKYGLKMNPTKCAFGVSAGQFLGFLVHERGIEITQRSINAIKKIKSPENKTDLQEM 489

Query: 424 IGMVNYYRRFLRNAAKLQAP 483
           IG + + RRF+ N ++   P
Sbjct: 490 IGKIIFVRRFISNLSRKLEP 509



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 2/43 (4%)
 Frame = +3

Query: 24  YQQIPVAPEDICKTAIITP--FGLYEFNYMTFGLRNAGQTFQR 146
           Y QI +A EDI KTA   P    L+E+  M+FGL++AG T+QR
Sbjct: 349 YNQIFMAEEDIHKTAFRYPGAISLFEWVVMSFGLKSAGATYQR 391



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLK 259
           Y+DD++V S++   H A LR +F+R +
Sbjct: 408 YIDDVVVKSKEIGDHIADLRKVFERTR 434


>10_08_0584 +
           18971761-18971834,18971852-18973133,18973197-18974509,
           18993885-18993935,18994674-18994829,18995048-18995123,
           18995317-18995364,18995445-18995489,18995580-18995679,
           18995923-18995968,18996115-18996176,18996257-18996355,
           18996536-18996609,18996721-18996790,18997074-18997162,
           18997327-18997404
          Length = 1220

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 26/47 (55%), Positives = 30/47 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +A ED  KTA ITP G Y +  M FGL+NAG TFQR
Sbjct: 584 LDAYSGYHQIRMAREDEEKTAFITPIGTYCYMTMPFGLKNAGPTFQR 630



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F+++    I +NP KCVFG P    LG  ISA G +   E+I+A++    P  ++ ++ 
Sbjct: 668 TFESLRTARIKLNPDKCVFGVPAGKLLGFLISARGIEANPEKIRAIERMRPPSKLRDVQC 727

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
             G +    RF+    +   PL
Sbjct: 728 VTGCMAALSRFISRLGEKALPL 749



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/47 (34%), Positives = 21/47 (44%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           P  WT E E      K  LSS  ++  P P+  L L+  A+   V A
Sbjct: 758 PFIWTEEAERALTQLKVYLSSPPVLVAPEPDEPLLLYLAATPQVVSA 804


>12_02_0065 -
           13109652-13110746,13110843-13111762,13139462-13139528,
           13139607-13139675,13139877-13140020,13140100-13140171,
           13140316-13140387,13140466-13140558,13140655-13140726,
           13140809-13140925
          Length = 906

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 27/58 (46%), Positives = 34/58 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALR 179
           +D   +Y QI + P DI KTA IT  G++    M FGLRNAG TF R + + T   LR
Sbjct: 492 LDAYSSYHQIHMNPPDIPKTAFITLLGIFCHLRMPFGLRNAGATFARLVYKETFDNLR 549



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 25/86 (29%), Positives = 40/86 (46%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F  +   GI +NP KCVFG      LG  +S  G +   E+I A++    P +V  +++
Sbjct: 544 TFDNLRAAGIKLNPEKCVFGIRAGKLLGFLVSERGIEANPEKIDAIQQMKPPSSVHEVQK 603

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAI 498
             G +    RFL   A+   P    +
Sbjct: 604 LAGRITALSRFLPKVAERGLPFFKTL 629



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +3

Query: 513 KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +G+   +WTPE +  F+  K  L S   +  P   +EL L+  AS   V A
Sbjct: 630 RGMGKFSWTPECQAAFDELKQYLQSPPALISPTLGSELLLYLAASPVAVSA 680


>08_02_0107 +
           12494650-12495270,12507463-12508146,12508325-12508472,
           12508493-12508584,12508713-12509426
          Length = 752

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 82  IDLRSGYHQLRIREEDIQKTAFTTRYGLYEFTVMSFGLTNAPAIFMNLMNK 132



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           ++K++    D F   ++DDILVYS+    H  HLR +  +L
Sbjct: 130 MNKVFMEYVDKFVVVFIDDILVYSQSEEDHQQHLRLVLGKL 170



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/50 (26%), Positives = 26/50 (52%)
 Frame = +3

Query: 513 KGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           K +    W+P+ E+ F   K+ L S+ ++  P  + +  ++ DAS   +G
Sbjct: 210 KKVEKFVWSPQCEKAFQTLKEKLVSSPVLILPDTHKDFLVYCDASRQGLG 259


>11_01_0792 + 6679002-6679603,6738490-6738520,6738532-6739644
          Length = 581

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 24/51 (47%), Positives = 31/51 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GLYEF  M+FGL NA   F   +++
Sbjct: 108 IDLRSGYHQLRIREEDIPKTAFTTRYGLYEFTVMSFGLTNAPAFFMNLMNK 158



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YS+    H  HLR +  +L+
Sbjct: 156 MNKVFMEYLDKFVVVFIDDILIYSQSEEDHQHHLRLVLGKLR 197


>04_01_0293 +
           3881375-3883698,3906619-3907636,3907820-3908309,
           3914729-3914823,3914854-3915213
          Length = 1428

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + + + ++ +    +KC F   EV FLG+ ISA G       ++++ ++  P+TV  +R 
Sbjct: 706 ALEKLREHQLYAKFSKCEFWLSEVKFLGHVISAGGVAVDPSNVESVTNWKQPKTVSEIRS 765

Query: 421 FIGMVNYYRRF 453
           F+G+  YYR F
Sbjct: 766 FLGLAGYYRSF 776



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 622 IDLRSGYHQLRIKEEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 672



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YSR   +H  HLR   ++L+
Sbjct: 670 MNKVFMEYLDKFVVVFIDDILIYSRTKEEHEEHLRLALEKLR 711


>04_01_0123 - 1283197-1283292,1283330-1284439,1284790-1285177,
            1285523-1287609
          Length = 1226

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 25/52 (48%), Positives = 32/52 (61%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
            +D    Y QI +A ED  KT+ ITPFG++ +  M FGL  AG TFQR +  A
Sbjct: 878  LDAYSGYHQISMAKEDEEKTSFITPFGVFCYVKMPFGLITAGNTFQRTVQGA 929



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 18/72 (25%), Positives = 37/72 (51%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            +F  +  Y +++NP  C FG P    LG  +   G +   E+I+A+++   P  ++ +++
Sbjct: 962  TFDNLRRYRLMLNPEMCTFGVPSGKMLGFLVFGRGIEVNPEKIKAIENMKSPTRLKEVQK 1021

Query: 421  FIGMVNYYRRFL 456
              G +    RF+
Sbjct: 1022 LTGCMAVLSRFV 1033



 Score = 34.3 bits (75), Expect = 0.091
 Identities = 17/38 (44%), Positives = 22/38 (57%)
 Frame = +3

Query: 534  WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDAS 647
            WT E EE F A K  LS+  ++  P PN EL L+  A+
Sbjct: 1055 WTQEAEEAFVALKRYLSNPPVLVAPKPNEELFLYIAAT 1092


>10_02_0167 -
           6100676-6102111,6102174-6102708,6102967-6103975,
           6104006-6105036
          Length = 1336

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 25/52 (48%), Positives = 31/52 (59%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +D    Y QI +A ED  K A ITPFG++ +  M FGL  AG TFQR +  A
Sbjct: 764 LDAYSGYHQISIAKEDEEKIAFITPFGVFCYVKMPFGLITAGNTFQRTVQGA 815



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 17/38 (44%), Positives = 22/38 (57%)
 Frame = +3

Query: 534  WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDAS 647
            WT E EE F A K  LS+  ++  P PN EL L+  A+
Sbjct: 916  WTQEAEETFIAFKRYLSNPPVLVAPQPNEELFLYIAAT 953


>09_02_0521 + 10162396-10162587,10162687-10163679
          Length = 394

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 23/49 (46%), Positives = 29/49 (59%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +D    Y QI +   D  KT+ ITPFG Y +  M FGL+NAG T+Q  I
Sbjct: 78  LDCYSGYHQIRLKESDYLKTSFITPFGAYCYITMPFGLKNAGATYQHMI 126



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 23/90 (25%), Positives = 43/90 (47%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F +I  + + +NP KC+FG P    LG  +S  G Q   E+I A+ +   P + + +++
Sbjct: 162 TFTSIRAFRMKLNPEKCIFGVPSGKLLGFMVSQRGIQANLEKINAILNMKPPSSQKNVQK 221

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAIVATE 510
             G +    RF+    +   P    +  T+
Sbjct: 222 LTGCMAALSRFVSRLGERGMPFFKLLKKTD 251



 Score = 27.9 bits (59), Expect = 7.9
 Identities = 13/42 (30%), Positives = 21/42 (50%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHV 659
           W PE ++ F   K  L++  ++A P P   L L+   +S  V
Sbjct: 255 WGPEAQKAFEDFKKLLTTPPVLASPRPQEPLLLYVSGTSQVV 296


>07_03_0508 - 18892193-18893119,18893183-18894528,18894594-18895206
          Length = 961

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 25/47 (53%), Positives = 30/47 (63%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D   +Y QI +A ED  KTA IT  G Y +  M FGL+NAG TFQR
Sbjct: 785 LDAYSSYHQIRMAREDEEKTAFITRIGTYCYTTMPFGLKNAGPTFQR 831



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            +F+++    I +NP KCVFG P    LG  ISA G +   E+I+A++    P  ++ ++ 
Sbjct: 869  TFESLRTARIKLNPDKCVFGVPAGKLLGFLISARGIEANPEKIRAIERMRPPSKLRDVQC 928

Query: 421  FIGMVNYYRRFLRNAAKLQAPL 486
              G +    RF+    +   PL
Sbjct: 929  VTGCMAALSRFISRLGEKALPL 950


>01_06_0717 -
           31446860-31447074,31447183-31447270,31448909-31449012,
           31449618-31449745,31450461-31450555,31461823-31463115,
           31463188-31464039,31464568-31464621
          Length = 942

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 25/47 (53%), Positives = 29/47 (61%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    Y QI +A ED  KTA ITP G Y +  M FGL+NA  TFQR
Sbjct: 434 LDAYSGYHQIRMAREDEEKTAFITPIGTYCYTTMPFGLKNARPTFQR 480



 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 30/117 (25%), Positives = 56/117 (47%), Gaps = 4/117 (3%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F+++    I +NP KCVFG P    LG  ++A G +   E+I+A++    P  ++ ++ 
Sbjct: 518 TFESLRSARIKLNPDKCVFGVPTGKLLGFLVTARGIEANPEKIRAIERMRPPSKLRDVQC 577

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAIVA----TEVKVSHRSLGHLSSKNALMPVKIA 579
             G +    RF+    +   PL   +      T  + + R+L  L +  +  PV +A
Sbjct: 578 VTGCMAALSRFISRLGEKALPLFKLLKCSGPFTWTEEAERALTQLKAYLSSPPVLVA 634



 Score = 31.9 bits (69), Expect = 0.49
 Identities = 17/47 (36%), Positives = 22/47 (46%)
 Frame = +3

Query: 525 PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           P TWT E E      K  LSS  ++  P P+  L L+  A+   V A
Sbjct: 608 PFTWTEEAERALTQLKAYLSSPPVLVAPKPDEPLLLYLAATPQVVSA 654


>01_05_0590 + 23480381-23481169
          Length = 262

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 23/49 (46%), Positives = 30/49 (61%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +D   +Y  I +   D  KT+ ITPFG Y +  M FGL+NAG T+QR I
Sbjct: 111 LDCYSSYHHICLKESDCLKTSFITPFGAYCYITMPFGLKNAGATYQRMI 159



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQT 402
           +F +I  + + +NP KC+FG P    LG  +S  G Q   E+I A+ +   P +
Sbjct: 195 TFASIRAFRMKLNPEKCIFGVPSGKLLGFMVSRRGIQANPEKINAILNMKPPSS 248


>10_05_0026 + 8262237-8262899,8263300-8263509,8263599-8265480,
            8265508-8265704,8275672-8275824
          Length = 1034

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 20/61 (32%), Positives = 36/61 (59%)
 Frame = +1

Query: 316  FLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAPLVNA 495
            FLG+ ISA G       ++++ ++  P+ V  +R F+G+  YYRRF+ N +K+  P+   
Sbjct: 921  FLGHVISAGGVAVDPSNVESVTNWKQPKIVSEIRSFLGLAGYYRRFIENFSKIDKPMTRL 980

Query: 496  I 498
            +
Sbjct: 981  L 981



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/51 (43%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA  T +GL+E   M+FGL NA   F   +++
Sbjct: 821 IDLRSGYHQLRIKEEDIPKTAFTTRYGLFECTVMSFGLTNAPAFFMNLMNK 871



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDIL+YSR   +H  HLR   ++L+
Sbjct: 869 MNKVFMEYLDKFVVVFIDDILIYSRTKEEHEEHLRLALEKLQ 910


>03_05_0527 +
           25220375-25221425,25221513-25222182,25222347-25222440,
           25222688-25222870
          Length = 665

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 20/59 (33%), Positives = 36/59 (61%)
 Frame = +1

Query: 310 VTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAPL 486
           V FLG+ I+A G       ++++  +  P+TV  +R F+G+  YYRRF+ N +++  P+
Sbjct: 606 VKFLGHVITAQGVAVDPSNVESVTKWTPPKTVSQIRSFLGLAGYYRRFIENFSRIARPM 664


>03_02_1026 +
           13313672-13313876,13341211-13342005,13363815-13363855,
           13363967-13364140
          Length = 404

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +  EDI KTA    +GLYEF  M+FGL NA   F   +++
Sbjct: 234 IDLCSGYHQLRIREEDIPKTAFTMRYGLYEFTVMSFGLTNAPAFFMNLMNK 284



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDILVYS+    H  HLR +  +L+
Sbjct: 282 MNKVFMEYLDKFVVVFIDDILVYSQSEEDHQHHLRLVLGKLR 323


>02_03_0347 - 17999780-18000592,18000656-18003019
          Length = 1058

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 24/46 (52%), Positives = 28/46 (60%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQ 143
            +D    Y QI +A ED  KTA ITP G Y +  M FGL+ AG TFQ
Sbjct: 920  LDAYSGYHQIRMAREDEEKTAFITPIGTYCYTTMPFGLKYAGPTFQ 965



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/53 (37%), Positives = 31/53 (58%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQ 399
            +F+++    I +NP KCVFG P    LG  ++A G +   E+IQA++    PQ
Sbjct: 1004 TFESLRSARIKLNPDKCVFGVPAGKLLGFLVTARGIEANPEKIQAIERMRPPQ 1056


>05_03_0294 +
           11818391-11820268,11820332-11820550,11820752-11821644,
           11829889-11829905,11829927-11830183
          Length = 1087

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 22/40 (55%), Positives = 28/40 (70%)
 Frame = +3

Query: 27  QQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           ++I +A ED  K+A ITP G Y +  M FGL+NAG TFQR
Sbjct: 698 REIRMAREDEKKSAFITPIGTYCYTTMPFGLKNAGPTFQR 737



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +1

Query: 241  SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
            +F+++    I +NP KCVFG P    LG  +SA G +   E+I+A++    P  ++ ++ 
Sbjct: 775  TFESLRTARIKLNPDKCVFGVPAGKLLGFLVSARGIEANPEKIRAIERMRPPNKLRDVQC 834

Query: 421  FIGMVNYYRRFLRNAAKLQAPL 486
              G +    RF+    +   PL
Sbjct: 835  VTGCMAALSRFISRLGEKALPL 856



 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/47 (34%), Positives = 21/47 (44%)
 Frame = +3

Query: 525  PITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            P  WT E E      K  LSS  ++  P P+  L L+  A+   V A
Sbjct: 865  PFIWTEEAERALTQLKAYLSSPPVLVAPEPDEPLLLYLAATPQVVSA 911


>05_03_0195 - 9560885-9561435,9561553-9561639,9562199-9563225
          Length = 554

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 24/43 (55%), Positives = 30/43 (69%), Gaps = 2/43 (4%)
 Frame = +3

Query: 24  YQQIPVAPEDICKTAIITP--FGLYEFNYMTFGLRNAGQTFQR 146
           Y QI +A ED+ KTA   P   GL+E+  MTFGL+NAG T+QR
Sbjct: 201 YNQIFMAEEDMYKTAFRCPGFVGLFEWVVMTFGLKNAGATYQR 243



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/64 (25%), Positives = 33/64 (51%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F+ +  YG+ +NP KC F      FLG  +   G +    +I+ ++DF  P   + +++
Sbjct: 281 AFERMRRYGLKMNPLKCAFDVSAGKFLGFMVHERGVEIDPNKIEKIRDFKAPTCKKEVQK 340

Query: 421 FIGM 432
            + +
Sbjct: 341 LLNI 344


>10_04_0010 - 7487455-7489490,7489569-7489980
          Length = 815

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           IDL   Y Q+ +   +I KTA  T +GLYEF  ++FGL NA   F   +++
Sbjct: 38  IDLRSGYHQLRIREANILKTAFTTRYGLYEFTVISFGLTNAPAFFMNLMNK 88



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 16/49 (32%), Positives = 29/49 (59%)
 Frame = +1

Query: 364 RIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAPLVNAIVATE 510
           ++ A+ D+  P+TV  +R F+G+  YY RF+ N +K+  P+   +   E
Sbjct: 137 KLTAVTDWKQPKTVTQIRSFLGLAGYYWRFIENFSKIARPMTQLLKKEE 185



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +2

Query: 137 VSKIYRRSYD-FCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           ++K++    D F   ++DDILVYS+    H  HLR +  +L+
Sbjct: 86  MNKVFMEYLDKFVVVFIDDILVYSQSEEDHQHHLRLVLGKLR 127



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           W+P+ E+ F   K+ L S+ ++  P    +  ++ DAS   +G
Sbjct: 189 WSPQCEKAFQTLKEKLVSSPVLILPDTRKDFMVYCDASRQGLG 231


>02_02_0305 + 8786599-8787184,8788613-8790001,8790370-8791196
          Length = 933

 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFP-LPQTVQGLRR 420
           F+ +E  G++++  K      +V FLG+ I            + +  FP      + L++
Sbjct: 526 FRKVEQNGLILSKKKMEICKEKVNFLGHEIGEGKIHLQEHIAKKILQFPDAMNDKKKLQQ 585

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
           F+G+VNY R  + N AKL  PL
Sbjct: 586 FLGLVNYARNHINNLAKLAGPL 607



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           DL   + Q+ +A E I  TA   P G YE+  M  GL+NA   FQR
Sbjct: 443 DLKAGFWQVKMAEESIEWTAFTCPQGHYEWLVMPLGLKNAPALFQR 488



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 12/41 (29%), Positives = 25/41 (60%)
 Frame = +2

Query: 137 VSKIYRRSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  I+  + +F   Y+DD+L++S+    H AHL   F++++
Sbjct: 490 MQNIFNDNQEFVLVYIDDLLIFSKTYKDHIAHLELFFRKVE 530


>07_03_1435 - 26532302-26533159,26533559-26534902,26535180-26535188
          Length = 736

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 22/90 (24%), Positives = 42/90 (46%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           +F +I  + + +N  KC+FG P    LG  +S  G Q   E+I A+ +   P + + +++
Sbjct: 32  TFASIRAFKMKLNLEKCIFGVPSGKLLGFMVSQRGIQANPEKINAILNMKPPSSQKDVQK 91

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAIVATE 510
             G +    RF+    +   P    +  T+
Sbjct: 92  LTGCMAALSRFVSRLGERGMPFFKLLKKTD 121


>01_01_0100 - 755894-756662,757086-757598,758718-761050
          Length = 1204

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFP-LPQTVQGLRRFIG 429
            +E  G++++  K      ++ FLG+ I            + + +FP      + L++F+G
Sbjct: 951  VEQNGLILSKKKMEICKEKINFLGHEIGEGKIHLQEHIAKKILEFPDAMNDKKKLQQFLG 1010

Query: 430  MVNYYRRFLRNAAKLQAPL 486
            +VNY R  + N AKL  PL
Sbjct: 1011 LVNYARNHINNLAKLAGPL 1029


>04_03_0647 + 18367321-18367675,18368044-18368885
          Length = 398

 Score = 36.3 bits (80), Expect = 0.023
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +1

Query: 307 EVTFLGNRISADGTQPPSERIQALKDFP-LPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           ++ FLG++I            + +  FP      + L++F+G+VNY R  + N AKL  P
Sbjct: 7   KINFLGHKIGEGKIHLQEHIAKKILQFPDAMNDKKKLQQFLGLVNYARNHINNLAKLAGP 66

Query: 484 L 486
           L
Sbjct: 67  L 67


>11_03_0064 + 9518810-9519164,9519533-9520359
          Length = 393

 Score = 35.9 bits (79), Expect = 0.030
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +1

Query: 307 EVTFLGNRISADGTQPPSERIQALKDFP-LPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           +V FLG+ I            + +  FP      + L++F+G+VNY R  + N AKL  P
Sbjct: 7   KVNFLGHEIGEGKIHLQEHIAKKILQFPDAMNDKKKLQQFLGLVNYARNHINNLAKLAGP 66

Query: 484 L 486
           L
Sbjct: 67  L 67


>10_07_0179 - 13860745-13861571,13861940-13862294
          Length = 393

 Score = 35.9 bits (79), Expect = 0.030
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +1

Query: 307 EVTFLGNRISADGTQPPSERIQALKDFP-LPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           +V FLG+ I            + +  FP      + L++F+G+VNY R  + N AKL  P
Sbjct: 7   KVNFLGHEIGEGKIHLQEHIAKKILQFPDAMNDKKKLQQFLGLVNYARNHINNLAKLAGP 66

Query: 484 L 486
           L
Sbjct: 67  L 67


>08_02_1451 - 27192418-27192423,27192424-27193146
          Length = 242

 Score = 35.9 bits (79), Expect = 0.030
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +1

Query: 307 EVTFLGNRISADGTQPPSERIQALKDFP-LPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           +V FLG+ I            + +  FP      + L++F+G+VNY R  + N AKL  P
Sbjct: 7   KVNFLGHEIGEGKIHLQEHIAKKILQFPDAMNDKKKLQQFLGLVNYARNHINNLAKLAGP 66

Query: 484 L 486
           L
Sbjct: 67  L 67


>09_01_0073 -
           1057560-1058043,1058199-1058385,1058754-1059062,
           1059427-1060269,1061572-1062552,1063189-1063516
          Length = 1043

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 3/57 (5%)
 Frame = +1

Query: 325 NRISADGTQPPSERIQALKDFPLPQTVQG---LRRFIGMVNYYRRFLRNAAKLQAPL 486
           NRI  +G     E I A K    P  +     L++F+G+VNY R  + N AKL  PL
Sbjct: 714 NRIQGEGKIHLQEHI-AKKILQFPDAMNDKKKLQQFLGLVNYARNHINNLAKLAGPL 769


>05_04_0184 - 18855062-18855604,18855889-18856611
          Length = 421

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +1

Query: 307 EVTFLGNRISADGTQPPSERIQALKDFP-LPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           ++ FLG+ I            + +  FP      + L++F+G+VNY R  + N AKL  P
Sbjct: 7   KINFLGHEIGEGKIHLQEHIAKKILQFPDAMNDKKKLQQFLGLVNYARNHINNLAKLAGP 66

Query: 484 L 486
           L
Sbjct: 67  L 67


>01_01_0676 + 5194718-5194940,5195420-5195952
          Length = 251

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 3/63 (4%)
 Frame = +1

Query: 307 EVTFLGNRISADGTQPPSERIQALKDFPLPQTVQG---LRRFIGMVNYYRRFLRNAAKLQ 477
           +++FLG+ I  +G     E I A K    P  +     L++F+G+VNY R  ++N AKL 
Sbjct: 7   KISFLGHEIG-EGKIHLQEHI-AKKFLQFPDAMNDKKELQQFLGIVNYARNHIQNLAKLA 64

Query: 478 APL 486
            PL
Sbjct: 65  GPL 67


>07_01_1218 -
           11633829-11634628,11634713-11635050,11635349-11635445,
           11635482-11635725,11636114-11636122
          Length = 495

 Score = 34.7 bits (76), Expect = 0.069
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 316 FLGNRISADGTQPPSERIQALKDFP--LPQTVQGLRRFIGMVNYYRRFLRNAAK 471
           FLG +I  D  QP +  I+  + FP  +    Q L+RF+G +NY   F ++ AK
Sbjct: 4   FLGYKIQYDQVQPVARVIEFAEKFPDEIKDKTQ-LQRFLGCLNYVSDFYKDLAK 56


>05_04_0308 -
           20081366-20082404,20082702-20083078,20084293-20084679,
           20085038-20086000
          Length = 921

 Score = 34.7 bits (76), Expect = 0.069
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 316 FLGNRISADGTQPPSERIQALKDFP--LPQTVQGLRRFIGMVNYYRRFLRNAAK 471
           FLG +I  D  QP +  I+  + FP  +    Q L+RF+G +NY   F ++ AK
Sbjct: 451 FLGYKIQYDQVQPVARVIEFAEKFPDEIKDKTQ-LQRFLGCLNYVSDFYKDLAK 503


>02_02_0538 - 11311171-11311596,11312507-11312581
          Length = 166

 Score = 34.7 bits (76), Expect = 0.069
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 316 FLGNRISADGTQPPSERIQALKDFP--LPQTVQGLRRFIGMVNYYRRFLRNAAK 471
           FLG +I  D  QP +  I+  + FP  +    Q L+RF+G +NY   F ++ AK
Sbjct: 26  FLGYKIQYDRVQPVARVIEFAEKFPDEIKDKTQ-LQRFLGCLNYVSDFYKDLAK 78


>10_05_0085 -
           9005539-9005922,9006207-9006463,9006707-9006883,
           9007349-9007490,9007814-9007904,9009024-9010942
          Length = 989

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 13/36 (36%), Positives = 23/36 (63%)
 Frame = +1

Query: 412 LRRFIGMVNYYRRFLRNAAKLQAPLVNAIVATEVKV 519
           L++F+G+VNY R  + N AKL  PL   ++  + ++
Sbjct: 745 LQQFLGLVNYARNHINNLAKLAGPLYAKLIKNDREI 780


>12_02_0356 +
           17915029-17916236,17932970-17933283,17933936-17934244,
           17934613-17935439
          Length = 885

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = +1

Query: 412 LRRFIGMVNYYRRFLRNAAKLQAPL 486
           L++F+G+VNY R  + N AKL  PL
Sbjct: 535 LQQFLGLVNYARNHINNLAKLAGPL 559


>04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305,
            9625520-9626032,9626801-9629153
          Length = 1342

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = +1

Query: 412  LRRFIGMVNYYRRFLRNAAKLQAPL 486
            L++F+G+VNY R  + N AKL  PL
Sbjct: 1037 LQQFLGLVNYARNHINNLAKLAGPL 1061


>12_02_1003 -
           25183468-25184010,25184295-25184551,25184795-25184971,
           25185438-25185905,25186720-25186730,25187589-25187599
          Length = 488

 Score = 32.3 bits (70), Expect = 0.37
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = +1

Query: 412 LRRFIGMVNYYRRFLRNAAKLQAPL 486
           L++F+G+VNY R  + N AKL  PL
Sbjct: 191 LQQFLGLVNYARNHINNLAKLGGPL 215


>04_04_0893 -
           29152150-29153156,29153234-29153561,29153645-29153879,
           29154149-29154194,29154579-29154711
          Length = 582

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 17/74 (22%), Positives = 36/74 (48%), Gaps = 1/74 (1%)
 Frame = +1

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLS-SKNALMPVKIACHLQLW 597
           F+ MV+ Y RFL++  +++      +    V+++     HL+ S  + + + + C  +L 
Sbjct: 209 FLFMVDRYLRFLQSRVRVRLVSARLLACDAVELNFCKSPHLTHSPMSTVFINVPCVSRLQ 268

Query: 598 WHTLCLTLN*GFSP 639
           WH   +T +    P
Sbjct: 269 WHPFTVTSSSSLEP 282


>10_01_0086 -
           1064650-1065379,1065796-1065950,1066029-1066141,
           1066238-1066345,1066773-1066890,1066996-1067069,
           1067595-1067690,1068062-1068455
          Length = 595

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = -3

Query: 577 LSLQALKHSSSSGVQVIGVRPLPQWPRSR*LAVLVTWPH 461
           +S   L H  S+G+Q + V PLP  P++   A  VT P+
Sbjct: 440 VSTPGLHHIPSNGIQTVFVAPLPITPKAVPFASAVTLPN 478


>12_02_0189 + 15165485-15168694
          Length = 1069

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 16/41 (39%), Positives = 20/41 (48%)
 Frame = +1

Query: 469 KLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPVKIACHLQ 591
           K   P +  I+A E+KV H  L  L  K  L P KI   L+
Sbjct: 214 KYVVPKLEKIIADEMKVQHSKLTDLMEKILLSPTKIDVKLK 254


>10_08_0262 +
           16307003-16308416,16309501-16309595,16309954-16309959,
           16310567-16310671
          Length = 539

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)
 Frame = +1

Query: 277 NPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR-RF 453
           NP+    G  E+  L     ADG +     + AL+  P  +T+  L  +    N  + R+
Sbjct: 128 NPSHDTLGDKEIAILS---CADGGE--QYVVTALRTIPGSKTIHRLHLYRSKPNGEQGRW 182

Query: 454 LRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSK 552
                 ++ PL+  +V    +  HR + H++SK
Sbjct: 183 TSQMVSVEGPLMRDLVCPIPETVHRQVHHVTSK 215


>10_07_0031 +
           12051846-12052059,12052360-12052410,12053514-12053520,
           12053621-12053804,12053920-12054001,12054174-12054243,
           12054460-12054574
          Length = 240

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 11/41 (26%), Positives = 21/41 (51%)
 Frame = +1

Query: 361 ERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           +R Q     P P  ++G+R F+G   +YR+ +    ++  P
Sbjct: 145 QRCQEKDLLPPPVNIKGIRSFLGHAGFYRKLVEMEDRMPIP 185


>02_02_0597 -
           11996350-11996483,11997511-11997604,11997877-11998032,
           11998580-11998639,11998733-11998951,11999038-11999377,
           12001240-12001571
          Length = 444

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = -3

Query: 610 KGCATRAADDKLSLQALKHSSSSGVQVIGVRPL 512
           +G A  AA DK+S++A+++  S+ V   G RP+
Sbjct: 32  RGGAMAAAGDKMSIRAVRYKISASVDDRGPRPV 64


>08_02_0362 -
           16230672-16230994,16231120-16231164,16231999-16232049,
           16232489-16232696
          Length = 208

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = +3

Query: 564 ACKDSLSSAALVAHPLPNAEL-GLFTDASSSH 656
           A   S+SS  LVA P P   + GLF D+SS++
Sbjct: 134 ATTPSMSSGGLVADPSPEGPIAGLFGDSSSAY 165


>07_03_0064 +
           12995669-12995904,12996299-12996533,12998223-12998384,
           12999446-12999566,13000095-13001608
          Length = 755

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 9/24 (37%), Positives = 17/24 (70%)
 Frame = +1

Query: 538 HLSSKNALMPVKIACHLQLWWHTL 609
           H SSK++L+P+K +  +  WW+ +
Sbjct: 120 HTSSKSSLIPLKFSLVVSSWWNRI 143


>10_07_0032 + 12096290-12097042,12097056-12098066,12110194-12110454
          Length = 674

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 11/43 (25%), Positives = 23/43 (53%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           W+P+ E+ F   K+ L ++ ++  P    +  ++ DAS   +G
Sbjct: 23  WSPQCEKAFRTLKEKLVASPVLILPDTRKDFIVYCDASRQGLG 65


>05_04_0035 + 17378541-17381276
          Length = 911

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEV--TFLGNRISADGTQPPSERIQALKDFPLPQTV 405
           QAI+  G+ + P + VFG P+V  +  G R    G   P  R   +     P  V
Sbjct: 624 QAIQPQGMPLRPQQPVFGGPQVDKSEFGGRPLQHGPSAPDPRQPGVVSMTQPPNV 678


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,283,227
Number of Sequences: 37544
Number of extensions: 340848
Number of successful extensions: 987
Number of sequences better than 10.0: 68
Number of HSP's better than 10.0 without gapping: 873
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 979
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1726796312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -