SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120012.Seq
         (701 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0719 + 5239238-5239635,5239735-5239945,5240379-5240454,524...    29   2.7  
03_05_0293 + 22849103-22849513,22849670-22849756,22850156-228502...    28   6.2  
03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714...    28   8.3  

>06_01_0719 +
           5239238-5239635,5239735-5239945,5240379-5240454,
           5240573-5240675,5241089-5241157,5241318-5241354,
           5241445-5241519,5241598-5241649,5241752-5241796,
           5241994-5242080,5242348-5242445
          Length = 416

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +3

Query: 141 KDIASSLKYGNCKDAVSRHVDKKY 212
           K +A S+  GN KD VSR +DK Y
Sbjct: 136 KTLAESMALGNIKDYVSRPMDKPY 159


>03_05_0293 +
           22849103-22849513,22849670-22849756,22850156-22850284,
           22850507-22851262,22853474-22854250
          Length = 719

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -1

Query: 143 LGHKLDLRVSLLE-HVPQRKRVLAEFELPDFNLS 45
           L  KL+     LE H+P R+  + +F+LP F +S
Sbjct: 329 LAEKLNSEPEFLEKHIPTRQVTVGQFKLPKFKIS 362


>03_02_0786 -
           11169820-11170158,11170245-11170433,11171173-11171469,
           11171568-11171630,11171884-11171997,11173011-11173091,
           11173176-11173307,11174265-11174363,11174453-11174530,
           11174641-11174901
          Length = 550

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 2/45 (4%)
 Frame = -3

Query: 264 LFGARAVVSPPTRCTYICIFYPRVCLQRLYN--FHILNCWRCPWP 136
           L G  A +       ++CI +P   L  L+N  F I + W  P P
Sbjct: 277 LLGFFAGIHLAILAAFVCIMHPHATLSSLFNSFFDIFSHWHWPLP 321


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,555,881
Number of Sequences: 37544
Number of extensions: 371605
Number of successful extensions: 955
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 933
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 954
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1803843684
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -