SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120009.Seq
         (721 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_02_0895 + 24094809-24094886,24097197-24097402,24097493-24097919     42   7e-04
04_04_0978 - 29856872-29858023                                         40   0.003
07_01_0422 + 3220988-3221536                                           37   0.019
03_06_0231 + 32522898-32523524                                         37   0.019
01_01_0792 - 6171400-6171957                                           36   0.024
04_04_0938 - 29525604-29526182                                         36   0.043
02_02_0268 + 8422024-8422623                                           36   0.043
07_01_0420 + 3212498-3213076                                           35   0.057
01_03_0016 + 11673258-11673854                                         35   0.057
09_04_0457 - 17736158-17737336                                         35   0.075
01_01_0797 - 6198401-6199114                                           35   0.075
03_02_0947 + 12640438-12640824                                         34   0.099
02_05_0341 - 28115835-28116404                                         34   0.099
08_02_1044 + 23913849-23915090                                         33   0.17 
12_02_0130 + 14026460-14027017                                         33   0.23 
02_04_0313 - 21947115-21948021,21948102-21948172                       33   0.23 
01_05_0802 + 25363556-25364011                                         33   0.23 
03_02_0946 + 12624196-12624675                                         33   0.30 
01_01_0412 - 3099509-3099634,3099758-3099904,3099991-3100089,310...    33   0.30 
02_02_0258 - 8374442-8375083                                           32   0.40 
06_01_0648 + 4689755-4690693                                           32   0.53 
02_04_0311 + 21936812-21937861                                         32   0.53 
01_03_0015 + 11669321-11670070                                         32   0.53 
12_02_0989 - 25069052-25070134                                         31   0.70 
09_06_0080 + 20736778-20737005,20737104-20737482,20737572-207376...    31   0.70 
05_01_0322 - 2538320-2538742,2539349-2539521,2539764-2539854,254...    31   0.70 
04_04_0058 - 22416949-22418196                                         31   0.70 
04_04_0057 + 22410167-22411330                                         31   0.70 
03_01_0350 - 2753217-2754152                                           31   0.70 
02_05_0665 - 30720842-30721003,30721290-30721448,30721555-307216...    31   0.70 
02_04_0312 - 21942310-21943356                                         31   0.70 
01_01_0795 - 6187518-6188219                                           31   0.70 
06_03_1188 + 28269231-28270358                                         31   0.92 
01_06_1646 - 38887178-38887271,38888230-38888270,38888744-388888...    31   0.92 
11_01_0227 + 1767191-1767847                                           31   1.2  
08_02_1507 - 27595369-27595803,27596086-27596264,27596371-27596539     31   1.2  
06_01_0807 - 6069998-6071326                                           31   1.2  
01_06_1319 - 36267285-36267992                                         31   1.2  
01_06_0752 + 31704071-31704787                                         31   1.2  
11_08_0071 + 28153043-28153555                                         30   1.6  
11_01_0084 - 640563-641000                                             30   1.6  
06_01_0396 - 2847739-2848332                                           30   1.6  
05_07_0353 + 29497953-29499110                                         30   1.6  
02_04_0254 - 21314861-21315805                                         30   1.6  
02_04_0252 - 21305834-21306778                                         30   1.6  
02_04_0250 - 21287782-21288726                                         30   1.6  
02_04_0248 - 21278756-21279700                                         30   1.6  
02_04_0246 - 21269730-21270674                                         30   1.6  
02_02_0267 - 8416184-8416684                                           30   1.6  
01_01_0794 - 6184622-6185317                                           30   1.6  
11_06_0368 + 22756988-22758205                                         30   2.1  
02_05_0378 - 28438918-28439064,28439280-28439313,28439859-284399...    30   2.1  
01_06_1228 - 35541160-35541729                                         30   2.1  
11_01_0258 + 1978191-1978404,1978464-1978693,1979601-1979966           29   2.8  
10_08_0785 - 20536265-20537032                                         29   2.8  
02_05_0816 + 31986370-31987662                                         29   2.8  
01_06_1454 + 37498513-37499154                                         29   2.8  
10_08_0620 - 19321612-19323237                                         29   3.7  
06_03_0367 - 19938941-19939324                                         29   3.7  
06_03_0343 + 19750914-19751047,19752091-19752676                       29   3.7  
06_03_0336 + 19671500-19672150,19672681-19673301                       29   3.7  
04_03_0908 + 20743436-20744018,20744128-20744168,20744320-207445...    29   3.7  
03_06_0238 - 32570222-32570330,32570538-32570599,32570658-325708...    29   3.7  
03_05_0500 + 24942047-24942541                                         29   3.7  
02_02_0262 - 8396755-8397244,8398659-8398705                           29   3.7  
12_02_0380 - 18356210-18356329,18356415-18356673,18356754-183569...    29   4.9  
12_01_0256 + 1895081-1895575,1896367-1896513,1897435-1897524           29   4.9  
11_08_0072 + 28154168-28154680                                         29   4.9  
11_01_0085 + 641579-641983                                             29   4.9  
09_02_0565 + 10710770-10711003,10711368-10711527,10712277-107124...    29   4.9  
08_02_0785 + 21190002-21190253,21190452-21190523,21191498-211916...    29   4.9  
05_04_0002 + 17031662-17032264                                         29   4.9  
04_04_0315 - 24331996-24332853                                         29   4.9  
02_02_0266 - 8410533-8411066                                           29   4.9  
12_01_0318 - 2425178-2425267,2425830-2426008,2426594-2426654,242...    28   6.5  
12_01_0086 + 690573-690998                                             28   6.5  
09_04_0460 - 17779111-17780184                                         28   6.5  
09_02_0436 - 9391496-9391596,9391671-9391742,9392535-9392742,939...    28   6.5  
06_01_1111 - 9148237-9148758                                           28   6.5  
05_05_0168 + 22875488-22876072                                         28   6.5  
05_03_0685 + 16992899-16993570                                         28   6.5  
05_03_0111 - 8512892-8512955,8513189-8513805                           28   6.5  
02_05_0619 + 30409313-30409785,30411257-30411746                       28   6.5  
02_05_0117 - 25986555-25987148                                         28   6.5  
02_04_0255 - 21323382-21323966                                         28   6.5  
02_02_0256 - 8362374-8363003                                           28   6.5  
01_01_0793 - 6182125-6182625                                           28   6.5  
12_01_0225 + 1714146-1714445,1714495-1714764                           28   8.6  
09_03_0128 + 12584166-12585320                                         28   8.6  
06_03_0347 + 19783824-19784348                                         28   8.6  
06_01_1048 + 8252404-8252517,8255799-8256266                           28   8.6  
02_05_1086 + 33994295-33994402,33994485-33994674,33994734-339947...    28   8.6  
02_05_0239 + 27101440-27101904                                         28   8.6  
01_06_0630 - 30723903-30724496                                         28   8.6  

>12_02_0895 + 24094809-24094886,24097197-24097402,24097493-24097919
          Length = 236

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +TEC ICLE+  D  G++       L  + +FH  C++RW R  +  P+ RA
Sbjct: 183 STECSICLERCGDADGLLE------LRCKHIFHSACLERWLRSRSDCPYCRA 228


>04_04_0978 - 29856872-29858023
          Length = 383

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           TT+C +CL +  D   +  +P          FH+QCI  W + H+  P  RA
Sbjct: 154 TTDCSVCLGEFSDGESLRLLP-----RCSHAFHQQCIDTWLKSHSNCPLCRA 200


>07_01_0422 + 3220988-3221536
          Length = 182

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 18/50 (36%), Positives = 24/50 (48%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           T C +CLE   D   + A+PD G L     FH +C+  W R+    P  R
Sbjct: 114 TCCPVCLENYGDGDVLRALPDCGHL-----FHRECVDPWLRQRPTCPVCR 158


>03_06_0231 + 32522898-32523524
          Length = 208

 Score = 36.7 bits (81), Expect = 0.019
 Identities = 18/53 (33%), Positives = 26/53 (49%)
 Frame = +3

Query: 72  TCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           TC+  C ICL+   D   +  +P+ G L     FH +C+  W R+H   P  R
Sbjct: 138 TCSC-CSICLDNYGDGDVLRMLPECGHL-----FHRECVDPWLRQHPTCPVCR 184


>01_01_0792 - 6171400-6171957
          Length = 185

 Score = 36.3 bits (80), Expect = 0.024
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +CL ++D    +  +P  G L     FH +C+  W R H+  P  RA
Sbjct: 98  DCAVCLGQVDAGEKVRQLPKCGHL-----FHAECVDAWLRAHSTCPMCRA 142


>04_04_0938 - 29525604-29526182
          Length = 192

 Score = 35.5 bits (78), Expect = 0.043
 Identities = 22/74 (29%), Positives = 30/74 (40%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFPQ 260
           +EC ICL   +    +  +P  G       FH  CI +W R H+  P  R I      PQ
Sbjct: 106 SECAICLSDFEHGDAMRVLPQCG-----HAFHAACIDKWLRGHSSCPSCRRI-LVLQLPQ 159

Query: 261 KR*RNATRCFEKPK 302
                  RC  +P+
Sbjct: 160 G--ERCQRCGARPE 171


>02_02_0268 + 8422024-8422623
          Length = 199

 Score = 35.5 bits (78), Expect = 0.043
 Identities = 17/50 (34%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL  + D   + A+P  G       FH  C+  W R H   P  RA
Sbjct: 119 ECAVCLSGMQDGDAVRALPGCG-----HAFHAGCVDAWLRAHGTCPVCRA 163


>07_01_0420 + 3212498-3213076
          Length = 192

 Score = 35.1 bits (77), Expect = 0.057
 Identities = 19/54 (35%), Positives = 23/54 (42%)
 Frame = +3

Query: 72  TCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T  T C +CLE       + A+P+ G L     FH  CI  W R     P  RA
Sbjct: 127 TAQTSCAVCLESYGGGDVLRALPECGHL-----FHRDCIFTWLRRRPTCPVCRA 175


>01_03_0016 + 11673258-11673854
          Length = 198

 Score = 35.1 bits (77), Expect = 0.057
 Identities = 17/50 (34%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +C+ ++ D     A+P  G       FH  C+  W R HT  P  RA
Sbjct: 125 ECAVCIAELRDGDECRALPRCG-----HRFHASCVDGWLRLHTTCPLCRA 169


>09_04_0457 - 17736158-17737336
          Length = 392

 Score = 34.7 bits (76), Expect = 0.075
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +C+ + DD+  +  +P         +FH+ CI  W   H   P  RA
Sbjct: 124 ECAVCISEFDDDETLRLLP-----KCSHVFHQDCIDTWLASHATCPVCRA 168


>01_01_0797 - 6198401-6199114
          Length = 237

 Score = 34.7 bits (76), Expect = 0.075
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +CL ++ D   +  +P     N   +FH +C+  W R  T  P  RA
Sbjct: 128 DCAVCLSELADGEKVRELP-----NCRHVFHVECVDAWLRSRTTCPLCRA 172


>03_02_0947 + 12640438-12640824
          Length = 128

 Score = 34.3 bits (75), Expect = 0.099
 Identities = 18/50 (36%), Positives = 25/50 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL ++ D      +P  G       FH +CI RW R ++  PF RA
Sbjct: 44  ECAVCLGEVRDGERGRLLPRCG-----HRFHVECIDRWFRANSTCPFCRA 88


>02_05_0341 - 28115835-28116404
          Length = 189

 Score = 34.3 bits (75), Expect = 0.099
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           EC ICL + +D   +  +P       +  FH  CI  W R H+  P  R +
Sbjct: 99  ECAICLVEFEDGQAVRVLPQC-----DHRFHAACIDTWLRAHSSCPSCRRV 144


>08_02_1044 + 23913849-23915090
          Length = 413

 Score = 33.5 bits (73), Expect = 0.17
 Identities = 16/50 (32%), Positives = 21/50 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + DD+  +  +P          FH  CI  W   H   P  RA
Sbjct: 144 ECAVCLSEFDDDETLRLLP-----RCSHAFHADCIDAWLASHVTCPVCRA 188


>12_02_0130 + 14026460-14027017
          Length = 185

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +C+  + D   +  +P  G       FH  C+  W R+H   P  RA
Sbjct: 122 QCAVCIAAVKDGDTVRRLPACG-----HAFHAPCVDGWLRDHATCPMCRA 166


>02_04_0313 - 21947115-21948021,21948102-21948172
          Length = 325

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 17/51 (33%), Positives = 22/51 (43%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T+C +CL +  D   +  +P  G       FH  CI  W R H   P  RA
Sbjct: 107 TDCPVCLGEFRDGELLRLLPKCG-----HAFHVPCIDAWLRAHVNCPLCRA 152


>01_05_0802 + 25363556-25364011
          Length = 151

 Score = 33.1 bits (72), Expect = 0.23
 Identities = 16/43 (37%), Positives = 17/43 (39%)
 Frame = +3

Query: 69  PTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           P     C IC EK    GG  A  D   L  E  FH  C+  W
Sbjct: 81  PGSDEACGICREKFGMGGGAGASSDPVNLPCEHAFHANCVLAW 123


>03_02_0946 + 12624196-12624675
          Length = 159

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +C+ ++ D      +P  G       FH +C+ +W R H   P  RA
Sbjct: 91  ECAVCIGELRDGDTGRLLPRCG-----HRFHAECVDKWFRSHATCPLCRA 135


>01_01_0412 -
           3099509-3099634,3099758-3099904,3099991-3100089,
           3100171-3100602,3101121-3101599,3101683-3101728
          Length = 442

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           +C ICLE+  DN  +      G+L     FH  C+++W +E    P
Sbjct: 396 KCAICLEEYKDNSLL------GILKCNHDFHTDCVKKWLKEKNSCP 435


>02_02_0258 - 8374442-8375083
          Length = 213

 Score = 32.3 bits (70), Expect = 0.40
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL +++    +  +P    + L  MFH +CI  W R+H+  P  R
Sbjct: 156 ECAVCLGEVEKGEMVKRLP----VCLH-MFHRRCIDPWLRDHSTCPVCR 199


>06_01_0648 + 4689755-4690693
          Length = 312

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 15/50 (30%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL ++ D   +  +P       +  FH +CI  W   H   P  RA
Sbjct: 102 ECAVCLSEVADGEKVRMLP-----KCDHGFHVECIDMWFHSHDTCPLCRA 146


>02_04_0311 + 21936812-21937861
          Length = 349

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 16/50 (32%), Positives = 19/50 (38%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL   DD   +  +P          FH  CI  W   H   P  RA
Sbjct: 122 ECAVCLTVFDDGDDLRLLPQCS-----HAFHPDCIDPWLEGHVTCPLCRA 166


>01_03_0015 + 11669321-11670070
          Length = 249

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +CL + +      A+P  G       FH +CI  W RE++  P  RA
Sbjct: 146 DCAVCLAEFEAGDKARALPRCG-----HRFHVECIDAWFRENSTCPLCRA 190


>12_02_0989 - 25069052-25070134
          Length = 360

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 17/54 (31%), Positives = 22/54 (40%)
 Frame = +3

Query: 72  TCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T   +C +CL +  D   + A+P          FH  CI  W R H   P  RA
Sbjct: 99  TAARDCAVCLLEFADGDELRALPLCA-----HAFHADCIDVWLRAHASCPLCRA 147


>09_06_0080 +
           20736778-20737005,20737104-20737482,20737572-20737615,
           20738491-20738612,20738701-20738809,20738933-20739046
          Length = 331

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 15/59 (25%), Positives = 28/59 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNF 254
           T +C IC  + +D   ++A+P       +  +H +CI +W + + R  F+    Y   F
Sbjct: 256 TEQCVICRVEFEDGESLIALP------CKHSYHPECINQWLQINKRALFDCQAAYVAKF 308


>05_01_0322 -
           2538320-2538742,2539349-2539521,2539764-2539854,
           2540005-2540121,2540327-2540392,2540933-2541025,
           2541661-2541721,2542634-2542707,2542782-2542848,
           2543342-2543400
          Length = 407

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = +3

Query: 69  PTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           PT  +EC ICLE+      +  +P          FH +CI +W R + + P
Sbjct: 249 PTDCSECPICLEEFHVGNEVRGLP------CAHNFHVECIDQWLRLNVKCP 293


>04_04_0058 - 22416949-22418196
          Length = 415

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 15/50 (30%), Positives = 21/50 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +CL +  D   +  +P  G       FH  CI  W R H   P  R+
Sbjct: 201 DCSVCLGEFQDGELVRLLPKCG-----HAFHVPCIDTWLRAHVNCPLCRS 245


>04_04_0057 + 22410167-22411330
          Length = 387

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 15/50 (30%), Positives = 20/50 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL   DD   +  +P     +    FH +CI  W       P  RA
Sbjct: 132 ECAVCLTSFDDGDDLRLLP-----HCSHAFHPECIDPWLESRVTCPLCRA 176


>03_01_0350 - 2753217-2754152
          Length = 311

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 15/51 (29%), Positives = 24/51 (47%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +EC +CL +  +   +  +P     N    FH  CI  W + + R PF R+
Sbjct: 126 SECAVCLSEFVERERVRLLP-----NCSHAFHIDCIDTWLQGNARCPFCRS 171


>02_05_0665 -
           30720842-30721003,30721290-30721448,30721555-30721687,
           30722042-30722227,30722377-30722906
          Length = 389

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 16/46 (34%), Positives = 20/46 (43%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           EC ICL   +D   + A+P          FH  CI +W R H   P
Sbjct: 337 ECCICLSSYEDGAELSALP------CNHHFHWTCITKWLRMHATCP 376


>02_04_0312 - 21942310-21943356
          Length = 348

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + +D+  +  +P          FH +CI  W  +H   P  RA
Sbjct: 128 ECAVCLLEFEDDDALRLLPAC-----PHAFHPECIGLWLEKHVTCPLCRA 172


>01_01_0795 - 6187518-6188219
          Length = 233

 Score = 31.5 bits (68), Expect = 0.70
 Identities = 14/51 (27%), Positives = 22/51 (43%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           + EC +CL  +D+   +  +P  G      +FH +CI  W       P  R
Sbjct: 114 SVECAVCLSAVDEGETVRQLPACG-----HVFHRECIDMWLSSRASCPVCR 159


>06_03_1188 + 28269231-28270358
          Length = 375

 Score = 31.1 bits (67), Expect = 0.92
 Identities = 13/36 (36%), Positives = 24/36 (66%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQ 191
           EC +CL++++D  G+VA P   + +   +FH QC++
Sbjct: 322 ECPVCLDELED--GVVAWPGCSVAH---VFHGQCLE 352


>01_06_1646 -
           38887178-38887271,38888230-38888270,38888744-38888827,
           38888933-38889080,38889232-38889299,38889563-38889634,
           38890479-38890673
          Length = 233

 Score = 31.1 bits (67), Expect = 0.92
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           EC+IC E+ D+         TG L   K  H +CIQRW
Sbjct: 41  ECRICQEEGDEGAMDSPCACTGTL---KFAHRKCIQRW 75


>11_01_0227 + 1767191-1767847
          Length = 218

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 15/49 (30%), Positives = 21/49 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL   ++   +  MP          FHE C+ RW R+    P  R
Sbjct: 164 ECAVCLSDFEEKDRLRTMP------CNHSFHENCLFRWLRDSCLCPLCR 206


>08_02_1507 - 27595369-27595803,27596086-27596264,27596371-27596539
          Length = 260

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C +CL+ ++D      +P+ G       FH +CI  W   H   P  R
Sbjct: 202 CSVCLQDLEDGERARRLPECG-----HTFHLRCIDSWLLRHASCPLCR 244


>06_01_0807 - 6069998-6071326
          Length = 442

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 15/49 (30%), Positives = 20/49 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL + DD+  +  +P          FH  CI  W   H   P  R
Sbjct: 153 ECAVCLSEFDDDEELRLLP-----KCSHAFHPDCIGEWLAGHVTCPVCR 196


>01_06_1319 - 36267285-36267992
          Length = 235

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 14/48 (29%), Positives = 20/48 (41%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C +CL+ ++  G  V  P       +  +H QCI  W   H   P  R
Sbjct: 89  CAVCLDDLEPGGSAVVTP------CDHAYHPQCIAPWLEAHDTCPLCR 130


>01_06_0752 + 31704071-31704787
          Length = 238

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 16/52 (30%), Positives = 23/52 (44%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           TTEC ICL  + +   +  +P         +FH  CI +W    +  P  RA
Sbjct: 114 TTECAICLGAMQEADAVRVLP-----ACRHVFHVACIDKWLASSSSCPVCRA 160


>11_08_0071 + 28153043-28153555
          Length = 170

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 15/49 (30%), Positives = 21/49 (42%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           C +CL +  D   +  +P+         FH  CI  W R +T  P  RA
Sbjct: 101 CPVCLSEFGDGEAVRVLPEC-----MHYFHVDCIGTWLRANTSCPLCRA 144


>11_01_0084 - 640563-641000
          Length = 145

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/51 (27%), Positives = 24/51 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           ++EC ICL ++++      +     +     FH++CI RW   H   P  R
Sbjct: 69  SSECSICLGELEEGERCCTL-----VACRHEFHKECIYRWLANHNTCPLCR 114


>06_01_0396 - 2847739-2848332
          Length = 197

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 16/50 (32%), Positives = 20/50 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C ICL        +  +P  G L     FH  C+  W R H   P  RA
Sbjct: 140 QCSICLGLARVGEAVRRLPSCGHL-----FHAGCVDEWLRAHATCPLCRA 184


>05_07_0353 + 29497953-29499110
          Length = 385

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 15/50 (30%), Positives = 20/50 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL + DD   +  +P          FH  C+ RW       P  RA
Sbjct: 123 ECAVCLARFDDADLLRLLP-----RCRHAFHLDCVDRWLESKASCPLCRA 167


>02_04_0254 - 21314861-21315805
          Length = 314

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/49 (28%), Positives = 22/49 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL +++D      +P  G       FH +C+  W   H+  P  R
Sbjct: 122 ECAVCLAELEDGEEARFLPRCG-----HGFHAECVDMWLGSHSTCPLCR 165


>02_04_0252 - 21305834-21306778
          Length = 314

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/49 (28%), Positives = 22/49 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL +++D      +P  G       FH +C+  W   H+  P  R
Sbjct: 122 ECAVCLAELEDGEEARFLPRCG-----HGFHAECVDMWLGSHSTCPLCR 165


>02_04_0250 - 21287782-21288726
          Length = 314

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/49 (28%), Positives = 22/49 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL +++D      +P  G       FH +C+  W   H+  P  R
Sbjct: 122 ECAVCLAELEDGEEARFLPRCG-----HGFHAECVDMWLGSHSTCPLCR 165


>02_04_0248 - 21278756-21279700
          Length = 314

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/49 (28%), Positives = 22/49 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL +++D      +P  G       FH +C+  W   H+  P  R
Sbjct: 122 ECAVCLAELEDGEEARFLPRCG-----HGFHAECVDMWLGSHSTCPLCR 165


>02_04_0246 - 21269730-21270674
          Length = 314

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/49 (28%), Positives = 22/49 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL +++D      +P  G       FH +C+  W   H+  P  R
Sbjct: 122 ECAVCLAELEDGEEARFLPRCG-----HGFHAECVDMWLGSHSTCPLCR 165


>02_02_0267 - 8416184-8416684
          Length = 166

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 13/49 (26%), Positives = 22/49 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           +C ICL  + D   +  +P+      + +FH +C+  W   H   P  R
Sbjct: 109 QCAICLGVVRDGEAVRRLPEC-----KHLFHVECVDMWLYSHATCPLCR 152


>01_01_0794 - 6184622-6185317
          Length = 231

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 25/73 (34%), Positives = 32/73 (43%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFNFPQK 263
           EC ICL  + D  G VA      ++L   FH  C+  W   HT  P  RA +   N P  
Sbjct: 142 ECSICLCAVAD--GEVARQLPRCMHL---FHRGCVDMWLVAHTTCPVCRA-EVVVNKPPD 195

Query: 264 R*RNATRCFEKPK 302
              +  RC E P+
Sbjct: 196 --EDDGRCAETPE 206


>11_06_0368 + 22756988-22758205
          Length = 405

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 15/49 (30%), Positives = 19/49 (38%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           C +CL +  D   +  +P          FH  CI  W R H   P  RA
Sbjct: 222 CAVCLTEFRDGETLRLLP-----RCRHAFHRGCIDTWLRAHVNCPLCRA 265


>02_05_0378 -
           28438918-28439064,28439280-28439313,28439859-28439963,
           28440402-28441558
          Length = 480

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 13/51 (25%), Positives = 22/51 (43%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           +T+C +CL +  +   +  +P          FH  CI  W + H+  P  R
Sbjct: 158 STDCSVCLGEFREGESLRLLP-----KCSHAFHVPCIDTWLKSHSNCPLCR 203


>01_06_1228 - 35541160-35541729
          Length = 189

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 14/50 (28%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C ICL + ++   + A+P  G       FH +C+  W R     P  R+
Sbjct: 126 QCSICLGEFEEGEKVKALPLCG-----HGFHPECVDAWLRSRPSCPLCRS 170


>11_01_0258 + 1978191-1978404,1978464-1978693,1979601-1979966
          Length = 269

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           EC +CLE  ++   +  MP       E  FHE C+ +W
Sbjct: 115 ECGVCLEGFEEGEKLRKMP------CEHYFHESCVFKW 146


>10_08_0785 - 20536265-20537032
          Length = 255

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 14/46 (30%), Positives = 20/46 (43%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           EC ICL +  +   +  MP  G       FH  C+  W R ++  P
Sbjct: 157 ECAICLSEFGEREEVRVMPQCG-----HGFHVACVDTWLRSNSSCP 197


>02_05_0816 + 31986370-31987662
          Length = 430

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 14/49 (28%), Positives = 21/49 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL + +D+  +  +P          FH  CI +W   H   P  R
Sbjct: 142 ECAVCLSEFEDDEMLRFLP-----KCSHAFHPDCIGQWLASHVTCPVCR 185


>01_06_1454 + 37498513-37499154
          Length = 213

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 14/40 (35%), Positives = 19/40 (47%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           +TEC ICL +      +  +P  G       FH +CI RW
Sbjct: 142 STECAICLSEFAQGHRVRVLPRCG-----HGFHARCIDRW 176


>10_08_0620 - 19321612-19323237
          Length = 541

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 14/49 (28%), Positives = 23/49 (46%)
 Frame = -3

Query: 275 IPLAFLGKVKIIFYSTIKRISSVFATPTLNALFVKHFFQV*HASVGHCH 129
           + L +L K KI+    ++R    F T TLN + +     +    +GH H
Sbjct: 312 LSLHYLAKAKIMVVKDVERDEIEFITKTLNCMPIASIEHLREDKLGHAH 360


>06_03_0367 - 19938941-19939324
          Length = 127

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 14/49 (28%), Positives = 21/49 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL  + +   +  +P       E ++H  CI RW   H   P  R
Sbjct: 69  ECAVCLGAVREGEMVRRLPAC-----EHVYHADCIDRWLAAHRTCPLCR 112


>06_03_0343 + 19750914-19751047,19752091-19752676
          Length = 239

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 14/49 (28%), Positives = 21/49 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL  + +   +  +P       E ++H  CI RW   H   P  R
Sbjct: 181 ECAVCLGAVREGEMVRRLPAC-----EHVYHADCIDRWLAAHRTCPLCR 224


>06_03_0336 + 19671500-19672150,19672681-19673301
          Length = 423

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 15/48 (31%), Positives = 19/48 (39%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C +CLE +     +  +P  G L     FH  CI  W   H   P  R
Sbjct: 148 CAVCLEDVVAGETVRRLPSCGHL-----FHVDCIDMWLHAHRTCPLCR 190



 Score = 29.1 bits (62), Expect = 3.7
 Identities = 15/50 (30%), Positives = 21/50 (42%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           C +CLE +     +  +P  G L     FHE C+  W R     P  R +
Sbjct: 358 CAVCLEDLRGGEMVRRLPACGHL-----FHEDCVDVWLRVRRTCPLCRRV 402


>04_03_0908 +
           20743436-20744018,20744128-20744168,20744320-20744588,
           20744793-20744832
          Length = 310

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 19/64 (29%), Positives = 26/64 (40%)
 Frame = +3

Query: 72  TCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAIKYYFN 251
           T +  C ICL   +D   +  +P          FH +CI RW    +  P  R  +  F 
Sbjct: 111 TVSPMCAICLSDFEDGEHVRVLP-----KCNHGFHVRCIDRWLLARSTCPTCR--QSLFG 163

Query: 252 FPQK 263
            PQK
Sbjct: 164 APQK 167


>03_06_0238 -
           32570222-32570330,32570538-32570599,32570658-32570883,
           32571165-32571532,32571644-32571743,32571817-32571879,
           32573077-32573123,32573222-32573353
          Length = 368

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = +3

Query: 75  CTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           C   C ICLE   DN      P T + + +  +H QCI  W +  ++ P
Sbjct: 26  CDDACSICLEAFCDND-----PST-VTSCKHEYHLQCILEWCQRSSQCP 68


>03_05_0500 + 24942047-24942541
          Length = 164

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 11/20 (55%), Positives = 12/20 (60%)
 Frame = +3

Query: 171 FHEQCIQRWRREHTRDPFNR 230
           FH  CI RW R+H R P  R
Sbjct: 108 FHAGCIDRWLRKHRRCPLCR 127


>02_02_0262 - 8396755-8397244,8398659-8398705
          Length = 178

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C +CLE++     +  MP       + +FH +CI  W   H   P  R
Sbjct: 105 CSVCLEELHAGEIVREMPAC-----KHLFHVECIDMWLHSHRTCPMCR 147


>12_02_0380 -
           18356210-18356329,18356415-18356673,18356754-18356917,
           18357235-18357397,18357465-18359020
          Length = 753

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +3

Query: 180 QCIQRWRREHTRDPFNRAIKYYFNFPQKR 266
           +C+Q++  EH     N A++YYF   Q R
Sbjct: 562 RCLQKFSHEHKAFLLNVAMEYYFELAQDR 590


>12_01_0256 + 1895081-1895575,1896367-1896513,1897435-1897524
          Length = 243

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 12/38 (31%), Positives = 19/38 (50%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           +C +CLE  ++   +  MP       E  FHE C+ +W
Sbjct: 132 QCGVCLEGFEEGDKLRKMP------CEHYFHESCVFKW 163


>11_08_0072 + 28154168-28154680
          Length = 170

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 16/51 (31%), Positives = 20/51 (39%)
 Frame = +3

Query: 81  TECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           T C +CL +  D   I  +P+         FH  CI  W R     P  RA
Sbjct: 116 TACPVCLSEFADGELIRLLPEC-----MHYFHAACIDEWLRTRATCPLCRA 161


>11_01_0085 + 641579-641983
          Length = 134

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = +3

Query: 84  ECQICLEKIDDN--GGIVAMPDTGML-NLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C ICL + +D+  GG        ML      FH+ C+ +W R  T  P  R+
Sbjct: 68  QCVICLSENEDDVDGGGGERGRGRMLPGCAHAFHKDCVVKWLRNRTTCPLCRS 120


>09_02_0565 +
           10710770-10711003,10711368-10711527,10712277-10712477,
           10712564-10712628,10712740-10712767,10712847-10712923,
           10713023-10713109,10713572-10713622,10713857-10713937,
           10714125-10714346,10714424-10714517,10714608-10714748,
           10716383-10716444,10716519-10717106
          Length = 696

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 16/48 (33%), Positives = 21/48 (43%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           C ICLE       +VA P         +FH++CI  W + H   P  R
Sbjct: 606 CTICLETFLAGEQVVATP------CNHIFHQECITPWVKGHGNCPVCR 647


>08_02_0785 +
           21190002-21190253,21190452-21190523,21191498-21191631,
           21191700-21191850,21191938-21192087
          Length = 252

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRW 197
           T EC+IC E  +DN   +  P     +L K  H  C+QRW
Sbjct: 58  TVECRICQE--EDNISNLESPCACTGSL-KYAHRACVQRW 94


>05_04_0002 + 17031662-17032264
          Length = 200

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 15/50 (30%), Positives = 21/50 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +C+ +  D      +P  G       FH  CI  W + H+  P  RA
Sbjct: 132 ECAVCIVEFRDGDRARLLPRCG-----HRFHADCIGAWLQLHSTCPLCRA 176


>04_04_0315 - 24331996-24332853
          Length = 285

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 14/42 (33%), Positives = 22/42 (52%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREH 209
           +C +C  + D + G V       L+ + +FH+ CI  W REH
Sbjct: 224 DCSMC--QYDKDAGAVVRT----LSCDHVFHKACIDVWLREH 259


>02_02_0266 - 8410533-8411066
          Length = 177

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 13/50 (26%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +CL  + +   +  +P       + +FH  CI  W   H+  P  RA
Sbjct: 115 QCAVCLSIVQEGETVRQLPAC-----KHLFHVGCIDMWLHSHSTCPLCRA 159


>12_01_0318 -
           2425178-2425267,2425830-2426008,2426594-2426654,
           2426851-2427160,2428514-2428777,2432595-2433865
          Length = 724

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 14/53 (26%), Positives = 24/53 (45%)
 Frame = +3

Query: 72  TCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           + +T+C +CL + ++   +  +P  G       FH  CI  W   H+  P  R
Sbjct: 508 SASTQCVVCLAEYEEKDVLRVLPYCG-----HGFHVACIDIWLMHHSTCPVCR 555


>12_01_0086 + 690573-690998
          Length = 141

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 5/55 (9%)
 Frame = +3

Query: 84  ECQICLEK----IDDNGGIVAMPDTGML-NLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C ICL +    +DD GG        ML      FH+ C+ +W R  T  P  R+
Sbjct: 71  QCVICLSESEDDVDDGGG--ERGRWRMLPGCAHAFHKDCVVKWLRNRTTCPLCRS 123


>09_04_0460 - 17779111-17780184
          Length = 357

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 14/50 (28%), Positives = 20/50 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +CL +  D   +  +P          FH  CI  W R H   P  R+
Sbjct: 156 DCAVCLGEFRDGELVRLLP-----RCSHPFHAPCIDTWLRAHVNCPLCRS 200


>09_02_0436 -
           9391496-9391596,9391671-9391742,9392535-9392742,
           9393413-9393707,9393782-9393916,9394624-9394898,
           9394976-9395149
          Length = 419

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 5/88 (5%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR-----AIKYYFN 251
           C ICL K  D+  +  +P T        FH QC+ +W + +   P  +      ++ +F 
Sbjct: 295 CCICLTKYGDDDELRELPCT------HFFHVQCVDKWLKINAVCPLCKTEIGGVVRSFFG 348

Query: 252 FPQKR*RNATRCFEKPKGL*AITKLIAF 335
            P  R R   R   +  G     KL+AF
Sbjct: 349 LPFGR-RRVDRMAGRGSG---FQKLLAF 372


>06_01_1111 - 9148237-9148758
          Length = 173

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +CLE+++       +P       E  FH  C+  W R+    P  RA
Sbjct: 89  DCAVCLEELEAGDRCRRLP-----RCEHSFHAPCVDSWLRKSRWCPVCRA 133


>05_05_0168 + 22875488-22876072
          Length = 194

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 13/51 (25%), Positives = 21/51 (41%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRAI 236
           +C IC+  +     + A+P  G       FH  C+  W R     P  R++
Sbjct: 126 QCSICISALVAGEKVKALPPCG-----HCFHPDCVDAWLRSQPSCPLCRSL 171


>05_03_0685 + 16992899-16993570
          Length = 223

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 15/50 (30%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC IC+ +  D      +P  G       FH +C+  W + H+  P  RA
Sbjct: 135 ECAICIAEFADGEEGRLLPRCG-----HRFHARCVDMWFQLHSTCPLCRA 179


>05_03_0111 - 8512892-8512955,8513189-8513805
          Length = 226

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 15/50 (30%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C ICL  +     +  +P       + MFH +CI  W   H+  P  RA
Sbjct: 148 QCVICLGLVQVGEVVRRLPAC-----KHMFHVECIDAWLSSHSTCPICRA 192


>02_05_0619 + 30409313-30409785,30411257-30411746
          Length = 320

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 15/50 (30%), Positives = 20/50 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CLE          +P       E  FH +C+  W R+    P  RA
Sbjct: 78  ECAVCLEAFQAGDRCRVLP-----RCEHGFHARCVDSWLRQSRVCPICRA 122


>02_05_0117 - 25986555-25987148
          Length = 197

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 2/52 (3%)
 Frame = +3

Query: 84  ECQICLEKIDDNGG--IVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC ICL ++ D GG  +  +P  G       FH  C+  W       P  RA
Sbjct: 144 ECAICLSELADGGGERVRVLPACG-----HGFHGACVDGWLAARASCPTCRA 190


>02_04_0255 - 21323382-21323966
          Length = 194

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 14/49 (28%), Positives = 21/49 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL K++D      +   G       FH +C+  W   H+  P  R
Sbjct: 109 ECAVCLAKLEDGEEARFLRRCG-----HGFHAECVDMWLGSHSTCPLCR 152


>02_02_0256 - 8362374-8363003
          Length = 209

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL ++        +P    + L  +FHE+CI  W   H   P  R+
Sbjct: 143 ECSVCLGEMRQGEAAKRLP----VCLH-VFHEECIDMWLGSHATCPICRS 187


>01_01_0793 - 6182125-6182625
          Length = 166

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           EC +CL  +++   + A+P          FH +C+  W R     P  RA
Sbjct: 100 ECAVCLGAVEEGETVRALPCC-----PHAFHARCVDAWLRLRPTCPLCRA 144


>12_01_0225 + 1714146-1714445,1714495-1714764
          Length = 189

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 15/49 (30%), Positives = 20/49 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL   ++   +  MP          FHE C+ RW  E    P  R
Sbjct: 135 ECAVCLRDFEEKDMLRTMP------CNHSFHEICLFRWLSESCLCPLCR 177


>09_03_0128 + 12584166-12585320
          Length = 384

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 15/50 (30%), Positives = 21/50 (42%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           +C +CL + D    +  +P  G       FH  CI  W R  +  P  RA
Sbjct: 143 DCAVCLCEFDGGDRLRLLPLCG-----HAFHAACIDTWLRSSSTCPLCRA 187


>06_03_0347 + 19783824-19784348
          Length = 174

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 12/49 (24%), Positives = 20/49 (40%)
 Frame = +3

Query: 84  ECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNR 230
           EC +CL  +     +  +P       + ++H +CI  W   H   P  R
Sbjct: 101 ECSVCLGAVQGGEAVRRLPAC-----KHLYHVECIDMWLASHATCPICR 144


>06_01_1048 + 8252404-8252517,8255799-8256266
          Length = 193

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 14/52 (26%), Positives = 23/52 (44%)
 Frame = +3

Query: 78  TTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           + EC ICLE++        +P+        +FH  C+  W +  +  P  RA
Sbjct: 126 SVECAICLERLRRGELCSELPEC-----RHVFHRDCVALWIKSKSTCPLCRA 172


>02_05_1086 +
           33994295-33994402,33994485-33994674,33994734-33994789,
           33995413-33995550,33995655-33995848,33996125-33996467
          Length = 342

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 19/71 (26%), Positives = 29/71 (40%)
 Frame = +3

Query: 30  RNYYMFKLFKDYWPTCTTECQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREH 209
           R  +  +L +   P    EC +CLE++     +  +P T        FH  C   W +  
Sbjct: 265 RRMWFRRLGRRPTPEEEEECAVCLEELRAGEAVAHLPCT------HRFHWGCAVPWVQTA 318

Query: 210 TRDPFNRAIKY 242
           +R P  RA  Y
Sbjct: 319 SRCPVCRAAVY 329


>02_05_0239 + 27101440-27101904
          Length = 154

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 12/45 (26%), Positives = 20/45 (44%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDP 221
           C ICL+ ++    +  +P        + FH+ C+ RW     R P
Sbjct: 91  CPICLDGMEAGRAVRVLP-----GCSRAFHQDCVDRWLTISPRCP 130


>01_06_0630 - 30723903-30724496
          Length = 197

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 15/49 (30%), Positives = 20/49 (40%)
 Frame = +3

Query: 87  CQICLEKIDDNGGIVAMPDTGMLNLEKMFHEQCIQRWRREHTRDPFNRA 233
           C ICL +  D   +  MPD         FH  C+  W R +   P  R+
Sbjct: 122 CSICLSEYADGEMLRVMPD-----CRHRFHVCCLDAWLRRNASCPVCRS 165


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,899,726
Number of Sequences: 37544
Number of extensions: 353821
Number of successful extensions: 1022
Number of sequences better than 10.0: 94
Number of HSP's better than 10.0 without gapping: 965
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 985
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1874582652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -