SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_01_0682 - 5244805-5244919,5246468-5246613,5246813-5246994,524...   126   1e-29
01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826...   120   8e-28
01_01_0509 - 3713109-3713244,3713689-3713733,3713959-3714015,371...   114   5e-26
01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204...   110   9e-25
11_06_0767 + 27121761-27123335,27123701-27123910,27124843-271249...   109   2e-24
07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553...   103   1e-22
03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009...   101   4e-22
03_02_0758 + 10954268-10954841,10955988-10957145,10957176-109572...   101   5e-22
11_06_0300 + 22095396-22096145,22096261-22096344,22097062-220973...    97   2e-20
06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244...    97   2e-20
08_01_0397 - 3509186-3510291,3510322-3512335                           94   1e-19
08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164,310...    91   6e-19
07_02_0023 - 11918735-11918827,11919139-11919231,11919320-119194...    87   9e-18
06_03_1255 + 28780181-28781172,28782065-28782932                       81   8e-16
12_02_1076 - 25862671-25863159,25863290-25863451,25863614-258638...    78   6e-15
04_04_0613 + 26617677-26617963,26618726-26618786,26619598-266198...    75   5e-14
03_06_0531 + 34552206-34552598,34552665-34552735,34553363-345533...    74   9e-14
03_05_0865 - 28365430-28367640                                         73   2e-13
07_01_0322 - 2258067-2258519,2258620-2258781,2258896-2259159,225...    73   2e-13
02_05_0096 + 25785995-25786311,25786716-25786776,25787825-257880...    72   4e-13
10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212...    70   1e-12
02_01_0765 - 5694535-5694644,5695039-5696550,5697229-5697390,569...    66   2e-11
02_05_1293 - 35520733-35520963,35521696-35521878,35522040-355222...    66   3e-11
09_05_0008 + 20042390-20042845,20043323-20043457,20043539-200436...    64   1e-10
01_05_0722 + 24598426-24598649,24599113-24599219,24599319-245993...    63   2e-10
01_05_0721 + 24594815-24594834,24595207-24595313,24595417-245954...    63   2e-10
05_01_0079 + 531617-531734,531987-532059,532152-532261,532400-53...    62   4e-10
01_01_0447 - 3327727-3328144,3328438-3328688,3328820-3328909,332...    61   9e-10
06_03_0287 - 19168685-19168735,19168847-19168884,19169517-191697...    59   3e-09
03_05_0052 - 20293197-20293310,20293938-20294024,20294133-202942...    58   6e-09
01_06_0020 + 25630728-25631023,25631308-25631548,25631629-256317...    58   6e-09
07_03_0601 - 19872780-19873099,19873148-19873151,19874196-198743...    58   9e-09
12_02_0340 - 17725866-17725884,17726046-17726326,17726842-177269...    56   3e-08
03_05_0619 - 26180980-26181105,26181329-26181417,26181518-261816...    54   1e-07
07_03_1566 + 27766336-27766393,27766480-27766609,27766728-277667...    53   2e-07
03_06_0344 - 33276366-33276548,33277044-33277169,33277254-332773...    53   2e-07
02_01_0355 + 2558792-2558862,2558993-2559099,2559185-2559615,256...    53   2e-07
06_03_0337 + 19678152-19678484,19678616-19678801,19679232-196794...    52   4e-07
08_02_0671 - 19890187-19890295,19891186-19891320,19891551-198919...    52   6e-07
01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237,448...    52   6e-07
07_03_1392 - 26238885-26239007,26239137-26239235,26239636-262397...    50   1e-06
06_03_1284 - 28988287-28988922,28989335-28989765,28989850-289899...    49   4e-06
01_05_0296 + 20567259-20567386,20568895-20569123,20569205-205694...    48   7e-06
01_05_0295 + 20537147-20537291,20539111-20539283,20539365-205395...    48   7e-06
07_03_1500 + 27001842-27002058,27002144-27002283,27002458-270025...    47   1e-05
02_01_0381 - 2764331-2764342,2768966-2769907                           47   2e-05
02_05_0064 - 25529630-25531440,25531663-25531673,25533113-255331...    41   8e-04
03_02_0189 - 6253659-6255380                                           41   0.001
03_05_0997 + 29565311-29565664,29566134-29566298,29566572-295666...    40   0.002
04_04_0476 - 25508952-25509004,25509245-25509326,25509453-255096...    38   0.006
01_07_0333 - 42813789-42814073,42814229-42814315,42815083-428151...    37   0.017
03_01_0059 + 484305-484617,484919-485406,485608-486092,486185-48...    36   0.039
02_05_1067 - 33858215-33858321,33858422-33858527,33859014-338592...    35   0.052
02_02_0099 + 6768115-6768285,6769950-6770034,6770501-6770628,677...    35   0.052
03_01_0399 + 3097878-3098141,3098254-3098547,3098659-3098886,309...    33   0.16 
11_04_0017 + 12297539-12297697,12298191-12298229,12298457-122988...    28   7.9  
06_03_0547 + 22001831-22002304                                         28   7.9  

>01_01_0682 -
           5244805-5244919,5246468-5246613,5246813-5246994,
           5247069-5247295,5247382-5247467,5247564-5247656,
           5247964-5248118,5248407-5248490,5248589-5248768,
           5249587-5249828,5249927-5249982
          Length = 521

 Score =  126 bits (305), Expect = 1e-29
 Identities = 59/84 (70%), Positives = 70/84 (83%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID +E   TNL+R TYLVLDEADRMLDMGFEPQI+KI+ QIRPDRQTL WSATWPKE
Sbjct: 197 GRLIDMIESHHTNLRRVTYLVLDEADRMLDMGFEPQIKKIVSQIRPDRQTLYWSATWPKE 256

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V++LA ++L D  ++ IGS +L A
Sbjct: 257 VEQLARNFLFDPYKVIIGSEELKA 280



 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 39/51 (76%), Positives = 42/51 (82%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           GSGKTLAY+LPAIVH+N QP +  GDGPI LVLAPTRELA QIQQ A  FG
Sbjct: 138 GSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQIQQEATKFG 188



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           NH I Q V+I  E +K NKL  LL++I      G++ +IF++TK+
Sbjct: 281 NHAISQHVEILSESQKYNKLVNLLEDI----MDGSRILIFMDTKK 321


>01_06_1758 -
           39681942-39682030,39682115-39682345,39682643-39682679,
           39683604-39683835,39683937-39684022,39684126-39684218,
           39684302-39684465,39684541-39684702,39684783-39684962,
           39685079-39685515,39685614-39685669
          Length = 588

 Score =  120 bits (290), Expect = 8e-28
 Identities = 55/84 (65%), Positives = 66/84 (78%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL+Y+LP +VH+  QP + +GDGPI L+LAPTRELA QIQQ +  FG  S  R+TC
Sbjct: 203 GSGKTLSYLLPGLVHVGAQPRLEQGDGPIVLILAPTRELAVQIQQESGKFGSYSRTRSTC 262

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDL RGVEIVIAT
Sbjct: 263 IYGGAPKGPQIRDLRRGVEIVIAT 286



 Score =  120 bits (289), Expect = 1e-27
 Identities = 60/87 (68%), Positives = 68/87 (78%), Gaps = 3/87 (3%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ---IRPDRQTLMWSATW 427
           GRLID LE G TNL+R TYLVLDEADRMLDMGFEPQIRKI+ Q   IRPDRQTL WSATW
Sbjct: 288 GRLIDMLEGGHTNLRRVTYLVLDEADRMLDMGFEPQIRKIVAQAWLIRPDRQTLYWSATW 347

Query: 428 PKEVKKLAEDYLGDYIQINIGSLQLSA 508
           P+EV+ LA  +L +  ++ IGS  L A
Sbjct: 348 PREVESLARQFLQNPYKVIIGSPDLKA 374



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 17/45 (37%), Positives = 30/45 (66%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           NH+I QI+++  EHEK  +L+ LL ++      G++ +IF +TK+
Sbjct: 375 NHSIQQIIEVISEHEKYPRLSKLLSDL----MDGSRILIFFQTKK 415


>01_01_0509 -
           3713109-3713244,3713689-3713733,3713959-3714015,
           3714088-3714438,3714585-3714862,3714939-3715289,
           3715378-3715647,3716035-3716103,3716194-3716304,
           3716503-3716583,3716825-3716914,3717032-3717262
          Length = 689

 Score =  114 bits (275), Expect = 5e-26
 Identities = 51/79 (64%), Positives = 66/79 (83%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    +L + +YLVLDEADRMLDMGFEPQIRKI++Q++P RQTLM++ATWPKE
Sbjct: 311 GRLNDILEMRRVSLHQVSYLVLDEADRMLDMGFEPQIRKIVKQVQPKRQTLMFTATWPKE 370

Query: 437 VKKLAEDYLGDYIQINIGS 493
           V+K+A D L + +Q+NIG+
Sbjct: 371 VRKIASDLLSNPVQVNIGN 389



 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 45/84 (53%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y++P  + +       R DGP  LVL+PTRELA QIQ  A  FG +S + + C
Sbjct: 227 GSGKTLGYLIPGFILLKRLQHNSR-DGPTVLVLSPTRELATQIQDEAKKFGRSSRISSVC 285

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDLERG +IV+AT
Sbjct: 286 LYGGAPKGPQLRDLERGADIVVAT 309



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 21/45 (46%), Positives = 28/45 (62%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N +I Q VD+    EK  +L+ +L+    SQEPG+K IIF  TKR
Sbjct: 396 NKSITQYVDVITPPEKSRRLDQILR----SQEPGSKIIIFCSTKR 436


>01_05_0292 +
           20518668-20519090,20519213-20519281,20520204-20520473,
           20520734-20521084,20521251-20521528,20522755-20523099,
           20523346-20523911,20525155-20525528
          Length = 891

 Score =  110 bits (265), Expect = 9e-25
 Identities = 51/80 (63%), Positives = 66/80 (82%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    +L++ +YLVLDEADRMLDMGFEPQIRKI+++I P RQTLM++ATWPKE
Sbjct: 281 GRLNDILEMRRISLKQVSYLVLDEADRMLDMGFEPQIRKIVKEIPPRRQTLMYTATWPKE 340

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           V+++AED L   +Q+ IGS+
Sbjct: 341 VRRIAEDLLVHPVQVTIGSV 360



 Score = 97.5 bits (232), Expect = 9e-21
 Identities = 47/84 (55%), Positives = 59/84 (70%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTL Y+LP  +HI       R  GP  LVLAPTRELA QI + A  FG +S + +TC
Sbjct: 197 GSGKTLGYLLPGFMHIKRLQNNPRS-GPTVLVLAPTRELATQILEEAVKFGRSSRISSTC 255

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GGAPK  Q RDL+RGV++V+AT
Sbjct: 256 LYGGAPKGPQLRDLDRGVDVVVAT 279



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N  I Q V++    EK  +L  +L+    SQ+ G+K +IF  TKR
Sbjct: 366 NSAITQNVELITPSEKLRRLEQILR----SQDSGSKVLIFCTTKR 406


>11_06_0767 +
           27121761-27123335,27123701-27123910,27124843-27124911,
           27125387-27125656,27126027-27126377,27126480-27126757,
           27126887-27128330
          Length = 1398

 Score =  109 bits (263), Expect = 2e-24
 Identities = 51/80 (63%), Positives = 65/80 (81%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D LE    +L + ++LVLDEADRMLDMGFEPQIRKI+++I  +RQTLM++ATWPKE
Sbjct: 735 GRLNDILEMRKISLHQVSFLVLDEADRMLDMGFEPQIRKIVDEIPRNRQTLMYTATWPKE 794

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           V K+A D L D +Q+NIGS+
Sbjct: 795 VTKIAGDLLKDPVQVNIGSI 814



 Score = 91.1 bits (216), Expect = 7e-19
 Identities = 47/87 (54%), Positives = 58/87 (66%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHIN---NQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKTL Y++PA +H+    N P +    GP  LVLAPTRELA QIQ  A  FG +S V 
Sbjct: 651 GSGKTLGYLIPAFIHLRRYQNNPML----GPTVLVLAPTRELASQIQDEAVKFGRSSRVS 706

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
            TC++GG  K  Q R+LERG +IV+AT
Sbjct: 707 CTCLYGGTSKGLQLRELERGADIVVAT 733



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           N +I Q V++    +K+ +L  +L+    +QE G+K IIF  TK+
Sbjct: 820 NKSITQYVEVVPPLDKQRRLEQILR----AQERGSKVIIFCSTKK 860


>07_01_0725 -
           5532803-5533324,5533631-5533657,5534285-5534398,
           5534564-5534731,5535951-5536193,5537178-5537261,
           5537357-5538117,5539637-5539730,5540633-5540899,
           5541311-5541316,5542538-5542657
          Length = 801

 Score =  103 bits (248), Expect = 1e-22
 Identities = 48/82 (58%), Positives = 65/82 (79%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
           GRL+D LE+   +LQ   YL LDEADRMLDMGFEPQIRKI+EQ+    R +RQT+++SAT
Sbjct: 460 GRLMDLLERARVSLQMIKYLALDEADRMLDMGFEPQIRKIVEQMDMPPRGERQTMLFSAT 519

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++++A D+L DYI + +G
Sbjct: 520 FPKEIQRMASDFLADYIFLAVG 541



 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI--NNQPPIRRGDG---PIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT A+  P I  I  +  PP  RG     P+AL+L+PTREL+ QI + A  F + + 
Sbjct: 370 GSGKTAAFCFPIISGIMRSRPPPRSRGSRTAYPLALILSPTRELSVQIHEEARKFAYQTG 429

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           V+    +GGAP  +Q R+LERGVEI++AT
Sbjct: 430 VKVVVAYGGAPITQQLRELERGVEILVAT 458


>03_06_0365 -
           33399422-33399925,33400470-33400583,33400762-33400929,
           33401305-33401547,33402148-33402231,33402323-33403098,
           33404423-33404636
          Length = 700

 Score =  101 bits (243), Expect = 4e-22
 Identities = 48/82 (58%), Positives = 64/82 (78%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
           GRL+D LE+   +LQ   YL LDEADRMLDMGFEPQIRKI+EQ+    R  RQT+++SAT
Sbjct: 374 GRLMDLLERARVSLQMVKYLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTMLFSAT 433

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++++A D+L DYI + +G
Sbjct: 434 FPKEIQRMASDFLADYIFLAVG 455



 Score = 78.6 bits (185), Expect = 4e-15
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-NNQPPIR-RGDG---PIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKT A+  P I  I +++PP R RG     P+AL+L+PTREL+ QI + A  F + + 
Sbjct: 284 GSGKTAAFCFPIISGIMSSRPPQRPRGSRTAYPLALILSPTRELSVQIHEEARKFAYQTG 343

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           VR    +GGAP  +Q R+LERGVEI++AT
Sbjct: 344 VRVVVAYGGAPIHQQLRELERGVEILVAT 372


>03_02_0758 +
           10954268-10954841,10955988-10957145,10957176-10957216,
           10957412-10957448,10957534-10957954,10958201-10958234
          Length = 754

 Score =  101 bits (242), Expect = 5e-22
 Identities = 47/80 (58%), Positives = 61/80 (76%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID L+     + R TYLVLDEADRM D+GFEPQIR I+ QIRPDRQTL++SAT P +
Sbjct: 351 GRLIDLLKMKALKMFRATYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPYK 410

Query: 437 VKKLAEDYLGDYIQINIGSL 496
           V++LA + L D I++ +G +
Sbjct: 411 VERLAREILTDPIRVTVGQV 430



 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 43/84 (51%), Positives = 56/84 (66%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++LP IVHI +QP + + +GPI +V APTRELA QI   A  F     +R   
Sbjct: 266 GSGKTAAFVLPMIVHIMDQPELEKEEGPIGVVCAPTRELAHQIYLEAKKFAKPYNLRVAA 325

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           V+GG  K +Q ++L+ G EIVIAT
Sbjct: 326 VYGGVSKFDQFKELKAGCEIVIAT 349


>11_06_0300 +
           22095396-22096145,22096261-22096344,22097062-22097304,
           22098535-22098702,22098895-22099008,22099378-22099890
          Length = 623

 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 45/82 (54%), Positives = 64/82 (78%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-RPD---RQTLMWSAT 424
           GRL+D LE+   +LQ   YL LDEADRMLDMGFEPQ+R+I+EQ+  P    RQT+++SAT
Sbjct: 294 GRLVDLLERARVSLQSIRYLALDEADRMLDMGFEPQVRRIVEQMDMPPPGARQTMLFSAT 353

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +PKE++++A D+L +YI + +G
Sbjct: 354 FPKEIQRMASDFLENYIFLAVG 375



 Score = 78.6 bits (185), Expect = 4e-15
 Identities = 42/91 (46%), Positives = 56/91 (61%), Gaps = 7/91 (7%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDG-------PIALVLAPTRELAQQIQQVAADFGHT 161
           GSGKT A+  P I  I   PP +R          P+AL+L+PTREL+ QI + A  F + 
Sbjct: 202 GSGKTAAFCFPIISGIMRGPPAQRPQRGGMRTACPLALILSPTRELSMQIHEEARKFSYQ 261

Query: 162 SYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           + VR    +GGAP  +Q RDLERGV+I++AT
Sbjct: 262 TGVRVVVAYGGAPINQQLRDLERGVDILVAT 292


>06_03_0674 +
           23422004-23422552,23423295-23423369,23424360-23424443,
           23424749-23424991,23425348-23425515,23425608-23425727,
           23426372-23427016
          Length = 627

 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 44/82 (53%), Positives = 64/82 (78%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
           GRL+D +E+   +L+   YLV+DEADRMLDMGFEPQIRKI+E++    +  RQT+++SAT
Sbjct: 252 GRLVDMVERSKVSLEAIKYLVMDEADRMLDMGFEPQIRKIVERMNMPRKSVRQTMLFSAT 311

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P E+++LA D+L +YI I +G
Sbjct: 312 FPPEIQRLASDFLSNYIFITVG 333



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 40/120 (33%), Positives = 49/120 (40%), Gaps = 36/120 (30%)
 Frame = +3

Query: 3   GSGKTLAYILPAIV-----------HINNQPPIRRGDGPIALVLAPTRELAQQ------- 128
           GSGKT A+ LP +            H       R    P ALVLAPTRELA Q       
Sbjct: 131 GSGKTAAFCLPVVSGLVAAGGSGIGHRERSSFNRAAAKPRALVLAPTRELAAQSFDNVIF 190

Query: 129 ------------------IQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
                             I + A  F   + +R    +GG P   Q RDLERG +I++AT
Sbjct: 191 IDTVNQNFSLFCYEELDNINEEAKKFSFQTGLRVVVAYGGTPMYNQLRDLERGADILVAT 250


>08_01_0397 - 3509186-3510291,3510322-3512335
          Length = 1039

 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 46/93 (49%), Positives = 65/93 (69%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R T+LV+DEADRM DMGFEPQI +I++  R
Sbjct: 544 LKRGAEIVVCTPGRMIDILCTSSGKITNLRRVTFLVMDEADRMFDMGFEPQITRIVQNTR 603

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+++SAT+P++V+ LA   L   ++I +G
Sbjct: 604 PDRQTVLFSATFPRQVEILARKVLTKPVEIQVG 636



 Score = 83.4 bits (197), Expect = 1e-16
 Identities = 37/84 (44%), Positives = 53/84 (63%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LP + H+ +QP +  GDGPI L++APTREL  QI      F     +    
Sbjct: 471 GSGKTLAFVLPMLRHVKDQPAVVPGDGPIGLIMAPTRELVVQIHSDIKKFSKALGINCVA 530

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG+   +Q  +L+RG EIV+ T
Sbjct: 531 IYGGSGVAQQISELKRGAEIVVCT 554


>08_01_0353 -
           3107628-3107774,3108177-3108213,3108248-3109164,
           3109210-3110952
          Length = 947

 Score = 91.5 bits (217), Expect = 6e-19
 Identities = 45/93 (48%), Positives = 64/93 (68%), Gaps = 3/93 (3%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           L  G+    C  GR+ID L   +   TNL+R T+LV+DEADRM DMGFEPQI +I++  R
Sbjct: 405 LKRGAEIVVCTPGRMIDILCTSSGKITNLRRVTFLVMDEADRMFDMGFEPQITRIVQNTR 464

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
           PDRQT+++SA +P++V+ LA   L   ++I +G
Sbjct: 465 PDRQTVLFSAIFPRQVEILARKVLTKPVEIQVG 497



 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 38/84 (45%), Positives = 55/84 (65%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA++LP + H+ +QPP+  GDGPI L++APTREL  QI      F  +  +    
Sbjct: 332 GSGKTLAFVLPMLRHVKDQPPVVPGDGPIGLIMAPTRELVVQIHSDIKKFAKSLGINCVA 391

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           ++GG+   +Q  +L+RG EIV+ T
Sbjct: 392 IYGGSGVAQQISELKRGAEIVVCT 415


>07_02_0023 -
           11918735-11918827,11919139-11919231,11919320-11919484,
           11920234-11920327,11921012-11921136,11921228-11921313,
           11921786-11921864,11923777-11923857,11924153-11924260,
           11924870-11924994,11925110-11925530
          Length = 489

 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 42/85 (49%), Positives = 61/85 (71%), Gaps = 1/85 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D +E G   L   +++VLDEADRMLDMGFEP++R I+ Q    RQT+M+SATWP  
Sbjct: 226 GRMKDLIEMGICRLNDVSFVVLDEADRMLDMGFEPEVRAILSQTASVRQTVMFSATWPPA 285

Query: 437 VKKLAEDYLG-DYIQINIGSLQLSA 508
           V +LA++++  + I++ IGS  L+A
Sbjct: 286 VHQLAQEFMDPNPIKVVIGSEDLAA 310



 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 37/87 (42%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN---QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT+A+ +PA++H+     +   ++G  P  LVL+PTRELAQQI  V  + G    + 
Sbjct: 139 GSGKTIAFGVPALMHVRRKMGEKSAKKGV-PRVLVLSPTRELAQQIADVLCEAGAPCGIS 197

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
           + C++GG  K  Q   L+ GV+IVI T
Sbjct: 198 SVCLYGGTSKGPQISALKSGVDIVIGT 224



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 9/31 (29%), Positives = 22/31 (70%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQ 600
           NH+++QIV++  +  ++++L  LL +  ++Q
Sbjct: 311 NHDVMQIVEVLDDRSRDSRLVALLDKYHKAQ 341


>06_03_1255 + 28780181-28781172,28782065-28782932
          Length = 619

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 36/78 (46%), Positives = 52/78 (66%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRL D L K   NL  C YL LDEADR++D+GFE  IR++ +  +  RQTL++SAT P++
Sbjct: 314 GRLKDLLSKKKMNLDNCRYLTLDEADRLVDLGFEDDIREVFDHFKAQRQTLLFSATMPEK 373

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++  A+  L   I +N+G
Sbjct: 374 IQNFAKSALVKPIIVNVG 391



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 35/93 (37%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQ----IQQVAADFGHT 161
           GSGKTL ++LP I+    +    PI  G+GP  L++ P+RELA+Q    I+   A     
Sbjct: 220 GSGKTLVFVLPLIMAALQEEILMPIVPGEGPFGLIVCPSRELARQTHEVIEMFLAPLMEA 279

Query: 162 SY--VRNTCVFGGAPKREQARDLERGVEIVIAT 254
            Y  +R     GG   R Q   +++GV IV+AT
Sbjct: 280 GYPEIRPLLCIGGVDMRTQMEVVKKGVHIVVAT 312


>12_02_1076 -
           25862671-25863159,25863290-25863451,25863614-25863838,
           25863939-25864037,25864584-25864992,25865094-25865221,
           25865955-25866329
          Length = 628

 Score = 78.2 bits (184), Expect = 6e-15
 Identities = 33/77 (42%), Positives = 55/77 (71%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID L++G  NL    ++VLDEAD+ML +GF+  +  I++++ P RQTLM+SAT P  
Sbjct: 228 GRVIDLLKRGALNLSEVRFVVLDEADQMLSVGFDEDVETILDRVPPKRQTLMFSATMPTW 287

Query: 437 VKKLAEDYLGDYIQINI 487
           +++L + YL + + I++
Sbjct: 288 IQRLTQKYLKNPVTIDL 304



 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 37/85 (43%), Positives = 54/85 (63%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAI-VHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTLA+ +P +   I +      G  P+A+VLAPTRELA+Q+++   +F  +S V   
Sbjct: 145 GTGKTLAFGIPILDAIIRHNEKNSPGKFPLAIVLAPTRELAKQVER---EFSDSSNVETI 201

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           CV+GG P  +Q R L  GV++VI T
Sbjct: 202 CVYGGTPISQQIRQLNYGVDVVIGT 226


>04_04_0613 +
           26617677-26617963,26618726-26618786,26619598-26619832,
           26619958-26620196,26620493-26620744,26620844-26621024,
           26621810-26621898,26622200-26622273,26622365-26622443
          Length = 498

 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 37/90 (41%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D  +KG   L+ C+ LV+DEAD++L   F+P I+++I  +  +RQ LM+SAT+P  
Sbjct: 251 GRILDLTKKGVCVLKNCSMLVMDEADKLLSPEFQPSIQELIRYLPSNRQILMFSATFPVT 310

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK+  + YL     IN+   L L  IT F+
Sbjct: 311 VKEFKDKYLPKPYVINLMDELTLKGITQFY 340



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 24/84 (28%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +PA+  I+      +      ++L PTRELA Q  QV  + G    ++   
Sbjct: 171 GTGKTAAFCIPALEKIDQDKNAIQ-----VVILVPTRELALQTSQVCKELGKHLKIQVMV 225

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   ++    L + V +++ T
Sbjct: 226 TTGGTSLKDDIVRLYQPVHLLVGT 249


>03_06_0531 +
           34552206-34552598,34552665-34552735,34553363-34553369,
           34553603-34553736,34553834-34554245,34554655-34554753,
           34555059-34555283,34555652-34556029,34556412-34556555,
           34556832-34556927,34557228-34557547,34557965-34558040
          Length = 784

 Score = 74.1 bits (174), Expect = 9e-14
 Identities = 34/77 (44%), Positives = 53/77 (68%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID +  G+  L    YLVLDEAD+ML +GFE  +  I++Q+  +RQ++++SAT P  
Sbjct: 263 GRIIDLINGGSLQLGEVKYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPGW 322

Query: 437 VKKLAEDYLGDYIQINI 487
           VKKL+  YL + + I++
Sbjct: 323 VKKLSRRYLNNPLTIDL 339



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP---IRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           G+GKTLA+ +P I  +  +     +RRG  P  LVLAPTRELA+Q+++   +      + 
Sbjct: 177 GTGKTLAFGIPMIKQLMEEDDGRSVRRGRIPRVLVLAPTRELAKQVEKEIKE--SAPKLS 234

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
             CV+GG     Q   L RGV++V+ T
Sbjct: 235 TVCVYGGVSYNVQQNALSRGVDVVVGT 261


>03_05_0865 - 28365430-28367640
          Length = 736

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 37/87 (42%), Positives = 52/87 (59%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI---RRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKT A++LP + +I   PPI      +GP A+V+APTRELAQQI++    F     ++
Sbjct: 362 GSGKTAAFVLPMLSYITRLPPISEENEAEGPYAVVMAPTRELAQQIEEETVKFATYLGIK 421

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              + GG    EQ   + +G E+VIAT
Sbjct: 422 VVSIVGGQSIEEQGFKIRQGCEVVIAT 448



 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 39/96 (40%), Positives = 58/96 (60%), Gaps = 17/96 (17%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIE-----QIRPD-------- 397
           GRL+D LE+    L +C Y+VLDEADRM+DMGFEPQ+  +++      ++P+        
Sbjct: 450 GRLLDCLERRYAVLNQCNYVVLDEADRMIDMGFEPQVVGVLDAMPSSNLKPENEDEELDA 509

Query: 398 ----RQTLMWSATWPKEVKKLAEDYLGDYIQINIGS 493
               R T M+SAT P  V++LA  YL + + + IG+
Sbjct: 510 KTIYRTTYMFSATMPPAVERLARKYLRNPVVVTIGT 545


>07_01_0322 -
           2258067-2258519,2258620-2258781,2258896-2259159,
           2259196-2259294,2259723-2260131,2260223-2260350,
           2261115-2261181,2262766-2262838,2262911-2263130
          Length = 624

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 32/77 (41%), Positives = 52/77 (67%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ID L +G  NL    ++VLDEAD+ML +GF+  +  I+E +  +RQ++++SAT P  
Sbjct: 223 GRIIDLLRRGVLNLSEIQFVVLDEADQMLAVGFDEDVEVIMENLPQNRQSMLFSATMPSW 282

Query: 437 VKKLAEDYLGDYIQINI 487
           ++K+   YL D I I++
Sbjct: 283 IRKITSKYLKDPIIIDL 299



 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 33/85 (38%), Positives = 54/85 (63%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI-NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTLA+ +P +  I  +      G  P+A++LAPTRELA+Q+++   +F  ++ + + 
Sbjct: 140 GTGKTLAFGIPIMDRILRHNEKNGSGRNPLAIILAPTRELARQVEK---EFKESAPLDSL 196

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           CV+GG P   Q R L  GV++V+ T
Sbjct: 197 CVYGGVPISHQMRALNYGVDVVVGT 221


>02_05_0096 +
           25785995-25786311,25786716-25786776,25787825-25788059,
           25788292-25788530,25789700-25789951,25790043-25790223,
           25790864-25790952,25791269-25791342,25791481-25791584,
           25791919-25791957,25792324-25792436
          Length = 567

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 35/90 (38%), Positives = 55/90 (61%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D  +KG   L+ C+ L++DEAD++L   F+P + ++I  +   RQ LM+SAT+P  
Sbjct: 261 GRILDLTKKGICILKDCSMLIMDEADKLLSPEFQPSVEQLIRYLPASRQILMFSATFPVT 320

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK+  + YL     IN+   L L  IT F+
Sbjct: 321 VKEFKDKYLPKPYVINLMDELTLKGITQFY 350



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 24/84 (28%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +PA+  I+ +    +      ++L PTRELA Q  QV  + G    ++   
Sbjct: 181 GTGKTAAFCIPALEKIDQEKNAIQ-----VVILVPTRELALQTSQVCKELGKHLKIQVMV 235

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   ++    L + V +++ T
Sbjct: 236 TTGGTSLKDDIIRLYQPVHLLVGT 259


>10_08_0553 -
           18720436-18720494,18721102-18721106,18721136-18721257,
           18721390-18721478,18722136-18722316,18722403-18722654,
           18722755-18722993,18723680-18723914,18724072-18724132,
           18724632-18724987
          Length = 532

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D   KG   L+ C+ LV+DEAD++L   F+P I ++I  +  +RQ LM+SAT+P  
Sbjct: 274 GRILDLTRKGICVLKDCSMLVMDEADKLLAPEFQPSIEQLIHFLPANRQLLMFSATFPVT 333

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           VK   E YL     IN+   L L  IT ++
Sbjct: 334 VKDFKEKYLPRPYVINLMDELTLKGITQYY 363



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 24/84 (28%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT A+ +PA+  I+ +    +      ++L PTRELA Q  QV  + G    ++   
Sbjct: 194 GTGKTAAFCIPALEKIDPEKNAIQ-----VVILVPTRELALQTSQVCKELGKYLNIQVMV 248

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG   ++    L + V +++ T
Sbjct: 249 STGGTSLKDDIMRLYQPVHLLVGT 272


>02_01_0765 -
           5694535-5694644,5695039-5696550,5697229-5697390,
           5698015-5698057
          Length = 608

 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD--GPIALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           GSGKT ++++P I H ++    R  D  GP+A+VLAPTREL  Q+++ A   G     + 
Sbjct: 229 GSGKTASFLVPIIAHCSHVRSERCTDKQGPLAIVLAPTRELCLQVEEQAKVLGKGLPFKT 288

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
             V GG P  +Q   +E G+E+++ T
Sbjct: 289 ALVVGGDPLAQQIYRIENGIELIVGT 314



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 29/79 (36%), Positives = 45/79 (56%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID L K   +L +    VLDE D +L+ GF  Q+ +I + +    Q +M+SAT   E
Sbjct: 316 GRLIDLLMKHNVDLNKVDVFVLDEVDCLLERGFRDQVMQIFQAL-SHPQVMMFSATVNSE 374

Query: 437 VKKLAEDYLGDYIQINIGS 493
           V+K++     + I I+ G+
Sbjct: 375 VEKMSNSLAKNAIHISCGN 393


>02_05_1293 -
           35520733-35520963,35521696-35521878,35522040-35522255,
           35522936-35523022,35523125-35523331,35523426-35523650,
           35523743-35523798,35524009-35524115,35524443-35525470
          Length = 779

 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 38/98 (38%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTT---NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL+D +E  ++    L     LVLDEAD +LD+GF   I KI++ +   RQTL++SAT 
Sbjct: 479 GRLLDHIENKSSFSVRLMGLKLLVLDEADHLLDLGFRTDIEKIVDSLPRQRQTLLFSATI 538

Query: 428 PKEVKKLAEDYL-GDYIQINIGSLQLSAITTFFKL*IF 538
           PKEV+++++  L  D++ ++  ++ L A+ T  K+ +F
Sbjct: 539 PKEVRRVSQLVLKRDHVFVD--TVGLGAVETPTKVIVF 574



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN--QPPIRRGDGPI-ALVLAPTRELAQQI 131
           G+GK+ A++LPAI  + N  +        PI +L+L PTRELA Q+
Sbjct: 389 GTGKSAAFLLPAIESVLNAMKSHTNHRVSPIFSLILCPTRELAIQL 434


>09_05_0008 +
           20042390-20042845,20043323-20043457,20043539-20043679,
           20043771-20043882,20044084-20044154,20044251-20044405,
           20044484-20044595,20044932-20045033,20045116-20045176,
           20045251-20045422,20045512-20045608,20045692-20045786,
           20045881-20046014,20046208-20046422
          Length = 685

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 37/89 (41%), Positives = 51/89 (57%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN--QPPIRRGD---GPIALVLAPTRELAQQIQQVAADFGHTSY 167
           G GKTLA++LP +  + N      RR D    P  LVL PTRELA+Q+    A +G T  
Sbjct: 151 GQGKTLAFVLPILESLVNGTHKASRRTDYGRPPTVLVLLPTRELAKQVHTDFAFYGATFG 210

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
           +   CV+GG+  R Q   + +GV+IV+ T
Sbjct: 211 LSACCVYGGSDYRSQEMAIRKGVDIVVGT 239



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 2/71 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR--PDRQTLMWSATWP 430
           GR+ DF+EKGT N +   + VLDEAD ML+MGF   +  I+ ++      QTL++SAT P
Sbjct: 241 GRVKDFVEKGTLNFRSLKFRVLDEADEMLNMGFVDDVELILGKVEDVTKVQTLLFSATIP 300

Query: 431 KEVKKLAEDYL 463
           + VKKL+  +L
Sbjct: 301 EWVKKLSLRFL 311


>01_05_0722 +
           24598426-24598649,24599113-24599219,24599319-24599374,
           24599469-24599675,24599757-24599963,24600037-24600123,
           24600167-24600208,24600209-24600304,24600406-24600621,
           24600693-24600875,24601014-24601241
          Length = 550

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 36/68 (52%), Positives = 48/68 (70%), Gaps = 3/68 (4%)
 Frame = +2

Query: 257 GRLIDFLEK--GTTN-LQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL D LE   G +N ++    LVLDEADR+LDMGF   I KII  I  +RQTL++SAT 
Sbjct: 205 GRLKDHLENTPGFSNRIKGVKVLVLDEADRLLDMGFRRDIEKIIAFIPKERQTLLFSATV 264

Query: 428 PKEVKKLA 451
           P+EV++++
Sbjct: 265 PEEVRQIS 272



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN-- 176
           G+GKT+A++LPAI  ++  P   R      LV+ PTRELA Q+   A       Y R+  
Sbjct: 121 GTGKTVAFLLPAIELLSTLP---RSPSINLLVICPTRELANQVAAEARKL--LKYHRSLG 175

Query: 177 -TCVFGGAPKREQARDLERG-VEIVIAT 254
              V GG    ++ R ++    +I++AT
Sbjct: 176 VQVVIGGTKLPQEQRSMQSNPCQILVAT 203


>01_05_0721 +
           24594815-24594834,24595207-24595313,24595417-24595472,
           24595562-24595810,24595871-24596077,24596157-24596243,
           24596331-24596426,24596500-24596715,24596908-24597090,
           24597222-24597449
          Length = 482

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 33/68 (48%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +2

Query: 257 GRLIDFLEKG---TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL D +E     +T L+    LVLDEADR+LDMGF   I +II  +  +RQTL++SAT 
Sbjct: 151 GRLKDHVENTPGFSTRLKGVKVLVLDEADRLLDMGFRRDIERIIASVPKERQTLLFSATV 210

Query: 428 PKEVKKLA 451
           P+EV++++
Sbjct: 211 PEEVRQIS 218



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 21/46 (45%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD---GPIALVLAPTRELAQQI 131
           G+GKT+A++LPAI  ++  P  RR         LV+ PTRELA Q+
Sbjct: 53  GTGKTVAFLLPAIEVLSALPNSRRDQLRPSINLLVMCPTRELAIQV 98


>05_01_0079 +
           531617-531734,531987-532059,532152-532261,532400-532543,
           532628-532736,532836-533182,533260-533333,533478-533782,
           534168-534294,534385-534414,534589-534837
          Length = 561

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 35/87 (40%), Positives = 51/87 (58%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI--NNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHT-SYVR 173
           G+GKTLAY+ P IVH+    +P + R DG  ALVL PTREL  Q+  +A    H   ++ 
Sbjct: 71  GTGKTLAYLAP-IVHLLQMREPRVERTDGTFALVLVPTRELCLQVYGIAQQLVHRFHWLV 129

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              + GG  + ++   L +G+ I+IAT
Sbjct: 130 PGYIMGGENRAKEKARLRKGISILIAT 156



 Score = 35.5 bits (78), Expect = 0.039
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 16/100 (16%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQ-RCTYLVLDEADRMLDMGFEPQIRKIIEQI--RPD---------- 397
           GRL+D L+  ++ +     ++V DEAD +L++GF   +  I+E +  R D          
Sbjct: 158 GRLLDHLQHTSSFVYPNMRWIVFDEADSILELGFGKALEDILEHLGSRNDTSNQNKNKME 217

Query: 398 ---RQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSA 508
              RQ L+ SAT  ++V +LA+  L + + I +     SA
Sbjct: 218 PMKRQNLLLSATLNEKVNRLAKISLKNPVMIGLDEQNSSA 257


>01_01_0447 -
           3327727-3328144,3328438-3328688,3328820-3328909,
           3329061-3329159,3329240-3329353,3329450-3329555,
           3329661-3329740,3329913-3330173,3330271-3330507,
           3330635-3330922
          Length = 647

 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 31/78 (39%), Positives = 52/78 (66%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           G+L D +E+  T N +    L+LDEADR+LD+GF+ QI  II ++   R+T ++SAT  +
Sbjct: 157 GKLFDVMERLDTLNYKNLEILILDEADRLLDLGFQKQITSIISKLPKLRRTGLFSATQTE 216

Query: 434 EVKKLAEDYLGDYIQINI 487
            VK+LA+  L + +++ +
Sbjct: 217 AVKELAKAGLRNPVRVEV 234



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 28/86 (32%), Positives = 48/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHT-SYVRNT 179
           GSGKTLA+++P +  +  +P   +    + ++++PTREL+ QI  VA  F  T   V + 
Sbjct: 70  GSGKTLAFVVPVVEILRRRPSPPKPHEVLGIIISPTRELSSQIYNVAQPFFATLKGVSSM 129

Query: 180 CVFGGAPKREQARDL-ERGVEIVIAT 254
            + GG   + + + L E G  I++ T
Sbjct: 130 LLVGGFDIKAELKKLEEEGANILVGT 155


>06_03_0287 -
           19168685-19168735,19168847-19168884,19169517-19169727,
           19171461-19171643,19171879-19172028,19172161-19172256,
           19172378-19172464,19172535-19172741,19172823-19173047,
           19173150-19173261,19173397-19173453,19175522-19176882
          Length = 925

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 31/67 (46%), Positives = 42/67 (62%), Gaps = 3/67 (4%)
 Frame = +2

Query: 257 GRLIDFLEKG---TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATW 427
           GRL D +E      T L     L+LDEADR+LDMGF   I +I+  +   RQTL++SAT 
Sbjct: 592 GRLKDHMENTPGFATRLMGVKVLILDEADRLLDMGFRTDIERIVAALPKQRQTLLFSATV 651

Query: 428 PKEVKKL 448
           P EV+++
Sbjct: 652 PDEVRQV 658



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 32/89 (35%), Positives = 46/89 (51%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPI--RRGDGPIA-LVLAPTRELAQQIQQVAADF--GHTSY 167
           G+GKT+A++LPAI  ++  PPI   +   PI+ +V+ PTRELA Q    A      H S 
Sbjct: 502 GTGKTVAFLLPAIEVVSKLPPIDCDKKRPPISVVVVCPTRELADQAAAEANKLLKFHPSI 561

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
                + G     EQ R      +I++AT
Sbjct: 562 GVQLVIGGTRMALEQKRMHTNPCQILVAT 590


>03_05_0052 -
           20293197-20293310,20293938-20294024,20294133-20294270,
           20295009-20295128,20295236-20295343,20296053-20296133,
           20296216-20296456,20297010-20297305
          Length = 394

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D +++ T   +    L+LDEAD ML  GF+ QI  +   + P+ Q  + SAT P E
Sbjct: 158 GRVCDMIKRRTLRTRAIKLLILDEADEMLGRGFKDQIYDVYRYLPPELQVCLISATLPHE 217

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D ++I +    L L  I  FF
Sbjct: 218 ILEMTSKFMTDPVRILVKRDELTLEGIKQFF 248



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 22/55 (40%), Positives = 29/55 (52%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           AL+L+PTRELA Q ++V    G    ++     GG    E  R LE GV +V  T
Sbjct: 102 ALILSPTRELAAQTERVMLAIGDYINIQVHACIGGKSIGEDIRKLEHGVHVVSGT 156


>01_06_0020 +
           25630728-25631023,25631308-25631548,25631629-25631709,
           25632109-25632216,25632329-25632448,25632806-25632943,
           25633064-25633150,25633802-25633915
          Length = 394

 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D +++ T   +    L+LDEAD ML  GF+ QI  +   + P+ Q  + SAT P E
Sbjct: 158 GRVCDMIKRRTLRTRAIKLLILDEADEMLGRGFKDQIYDVYRYLPPELQVCLISATLPHE 217

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D ++I +    L L  I  FF
Sbjct: 218 ILEMTSKFMTDPVRILVKRDELTLEGIKQFF 248



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 22/55 (40%), Positives = 29/55 (52%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           AL+L+PTRELA Q ++V    G    ++     GG    E  R LE GV +V  T
Sbjct: 102 ALILSPTRELAAQTERVMLAIGDFINIQVHACIGGKSIGEDIRKLEHGVHVVSGT 156


>07_03_0601 -
           19872780-19873099,19873148-19873151,19874196-19874357,
           19874429-19874617,19874687-19875010,19875103-19875378,
           19875436-19875478,19876110-19876188,19876473-19876555,
           19876708-19876782,19877324-19877490,19877960-19878370
          Length = 710

 Score = 57.6 bits (133), Expect = 9e-09
 Identities = 32/82 (39%), Positives = 49/82 (59%), Gaps = 3/82 (3%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTT-NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           C  GRL+  + + T  +  +   LV+DEAD++LD  F+ Q+  ++ Q+   RQTL++SAT
Sbjct: 357 CTPGRLLQHMGETTNFDCSQIQILVIDEADQVLDKNFQEQVDNVVSQLPKVRQTLLFSAT 416

Query: 425 WPKEVKKLAEDYLGD--YIQIN 484
             K VK LA   L D  YI ++
Sbjct: 417 QTKSVKDLARVSLKDPEYISVH 438



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 15/59 (25%), Positives = 27/59 (45%)
 Frame = +3

Query: 78  DGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           DG   +VL+P ++LA QI  V    G        C+ G     ++ + +   + I++ T
Sbjct: 300 DGVGCIVLSPNKDLAGQIFNVFQKVGKLHGFSAACIVGNRKGLDEEKAVINNMNILVCT 358


>12_02_0340 -
           17725866-17725884,17726046-17726326,17726842-17726928,
           17727018-17727113,17728484-17728585,17728720-17728762,
           17728834-17728952,17729348-17729444,17730153-17730214,
           17730370-17730432,17730847-17730949,17731402-17731497,
           17731594-17731742,17732356-17732529,17733078-17733156,
           17733807-17733913,17733994-17734062,17734879-17735043,
           17735206-17735703
          Length = 802

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 1/65 (1%)
 Frame = +2

Query: 257 GRLIDFLEKG-TTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR+ID L    +  L+    L+LDEADR+L++GF  +I+++I      RQT+++SAT  +
Sbjct: 324 GRIIDHLRNSLSVGLEDLAILILDEADRLLELGFSAEIQELIRMCPRRRQTMLFSATMTE 383

Query: 434 EVKKL 448
           E+ +L
Sbjct: 384 EINEL 388



 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 28/84 (33%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP +  +  +P  +R      L+L PTRELA Q+  +       + +R   
Sbjct: 241 GSGKTAAFSLPVLERLLFRP--KRVPAIRVLILTPTRELAAQVHSMIEKLAQFTDIRCCL 298

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG   + Q   L    +IV+AT
Sbjct: 299 IVGGLSTKVQEVALRSMPDIVVAT 322


>03_05_0619 -
           26180980-26181105,26181329-26181417,26181518-26181629,
           26181711-26181848,26182004-26182150,26182458-26182532,
           26182627-26182668,26183033-26183152,26183806-26183880,
           26184051-26184113,26184690-26184759,26184877-26185006,
           26185097-26185328
          Length = 472

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 30/81 (37%), Positives = 50/81 (61%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRL+D L   KG + L +  YLVLDEAD++L++ F+  +  I+  I  +R+T ++SAT  
Sbjct: 170 GRLLDHLTDTKGFS-LNKLKYLVLDEADKLLNVEFQKALDDILNVIPKERRTFLFSATMT 228

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
            +V KL    L + +++ + S
Sbjct: 229 NKVSKLQRACLRNPVKVEVAS 249



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 32/84 (38%), Positives = 42/84 (50%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I  +  Q    +     A VL+PTRELA QI Q     G    +  T 
Sbjct: 88  GSGKTGAFALPIIQALLKQD---KPQALFACVLSPTRELAFQIGQQFEALGSAIGLSCTV 144

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG  + +QA  L +   IV+ T
Sbjct: 145 LVGGVDRVQQAVSLAKRPHIVVGT 168


>07_03_1566 +
           27766336-27766393,27766480-27766609,27766728-27766797,
           27767134-27767196,27767741-27767815,27768035-27768154,
           27768508-27768549,27768651-27768725,27768909-27769055,
           27769165-27769302,27769448-27769562,27769658-27769746,
           27770062-27770184
          Length = 414

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWP 430
           GRL+D L   KG +   +  YLVLDEAD +L + F+  +  I+  I  +R+T ++SAT  
Sbjct: 112 GRLLDHLTNTKGFS-FNKLKYLVLDEADDLLKVDFQKAVDDILNVIPKERRTFLFSATMT 170

Query: 431 KEVKKLAEDYLGDYIQINIGS 493
           ++VKKL    L + +++ + S
Sbjct: 171 EKVKKLRRACLKNPVKVEVAS 191



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 31/86 (36%), Positives = 42/86 (48%), Gaps = 2/86 (2%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGP--IALVLAPTRELAQQIQQVAADFGHTSYVRN 176
           GSGKT A+ LP I     Q  +     P   A VLAPTRELA QI +     G    ++ 
Sbjct: 30  GSGKTAAFALPII-----QALLEHEHRPCFFACVLAPTRELAIQIAKQFEALGSAISLQC 84

Query: 177 TCVFGGAPKREQARDLERGVEIVIAT 254
           + + GG P+  Q   L +   +V+ T
Sbjct: 85  SVLIGGIPRTSQTISLAKRPHVVVGT 110


>03_06_0344 -
           33276366-33276548,33277044-33277169,33277254-33277322,
           33277401-33277505,33277595-33277633,33277717-33278016,
           33278093-33278182,33278271-33278312,33278433-33278516,
           33278762-33278947,33279218-33279403,33279663-33280025
          Length = 590

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 31/84 (36%), Positives = 49/84 (58%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++PAI  +++   + R +G   +V+ PTRELA Q   VA +           
Sbjct: 143 GSGKTLAFLIPAIEMLHHAHFMPR-NGTGVVVVCPTRELAIQTHNVAKELMKYHSQTLGY 201

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG  +R +A  L +GV +++AT
Sbjct: 202 IIGGNGRRGEADQLAKGVNLLVAT 225



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 25/67 (37%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNL-QRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL+D L+     + +R   L++DEADR+L+  FE  +++I +++  +RQT+++SAT  +
Sbjct: 227 GRLLDHLQNTKGFIYRRLKCLIIDEADRLLEQNFEEDMKQIFKRLPLNRQTVLFSATQTE 286

Query: 434 EVKKLAE 454
           +VK+ A+
Sbjct: 287 QVKEFAK 293


>02_01_0355 +
           2558792-2558862,2558993-2559099,2559185-2559615,
           2560100-2560735
          Length = 414

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 35/118 (29%), Positives = 52/118 (44%), Gaps = 2/118 (1%)
 Frame = +2

Query: 176 HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGF 355
           H CV   S +     L  G        GR+ D L + +         VLDEAD ML  GF
Sbjct: 141 HACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRPDHIKMFVLDEADEMLSRGF 200

Query: 356 EPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + QI  I + + P  Q  ++SAT P E  ++   ++   ++I +    L L  I  F+
Sbjct: 201 KDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFY 258



 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 26/55 (47%), Positives = 32/55 (58%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           +LVLAPTRELAQQI++V    G    V+     GG   RE  R L  GV +V+ T
Sbjct: 112 SLVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGT 166


>06_03_0337 +
           19678152-19678484,19678616-19678801,19679232-19679417,
           19680840-19680926,19681045-19681086,19681164-19681253,
           19681399-19681503,19681797-19681835,19681914-19682018,
           19682463-19682531,19682587-19682736,19683156-19683335
          Length = 523

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 34/87 (39%), Positives = 46/87 (52%), Gaps = 3/87 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAI---VHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 173
           GSGKTLA+++PAI     +   P  R G G   +VL PTRELA Q   VA +        
Sbjct: 133 GSGKTLAFLIPAIELLCRLRFSP--RNGTG--VIVLCPTRELAIQTHNVAKELMRYHSQT 188

Query: 174 NTCVFGGAPKREQARDLERGVEIVIAT 254
              V GG   R +A  L +G+ +++AT
Sbjct: 189 LGYVIGGIDLRGEAEQLAKGINVLVAT 215



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 26/68 (38%), Positives = 46/68 (67%), Gaps = 2/68 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTY-LVLDEADRMLDMGFEPQIRKIIEQI-RPDRQTLMWSATWP 430
           GRL+D ++K  +    C   L++DEADR+L+  FE Q+++I + + R  RQT+++SAT  
Sbjct: 217 GRLLDHMQKTKSFKYECLKCLIIDEADRILEQNFEEQMKQIFKLLPRQGRQTVLFSATQT 276

Query: 431 KEVKKLAE 454
           ++V+  A+
Sbjct: 277 EKVEDFAK 284


>08_02_0671 -
           19890187-19890295,19891186-19891320,19891551-19891917,
           19892909-19893044,19894924-19894974,19895053-19895134,
           19895801-19895853,19895989-19896065,19896234-19896273,
           19897666-19897767,19897989-19898031,19898127-19899288,
           19899902-19900271
          Length = 908

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 29/84 (34%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+++P I  +        G G  AL+L+PTR+LA Q  + A   G  + ++ + 
Sbjct: 73  GSGKTAAFLVPMIQRLRRHDA---GAGIRALILSPTRDLATQTLKFAQQLGKFTDLKISL 129

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     Q  +L    +I+IAT
Sbjct: 130 IVGGDSMESQFEELAENPDIIIAT 153



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 1/72 (1%)
 Frame = +2

Query: 257 GRLIDFL-EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL+  L E    NL+   Y+V DEAD +  +G   Q+  I+ ++   RQTL++SAT P+
Sbjct: 155 GRLVHHLAEVEDLNLRTVEYVVFDEADSLFSLGLIQQLHDILHKLSDTRQTLLFSATLPQ 214

Query: 434 EVKKLAEDYLGD 469
            +   A+  L D
Sbjct: 215 ALADFAKAGLRD 226


>01_01_0602 -
           4484972-4485450,4485949-4485997,4486108-4486237,
           4486636-4486778,4486819-4486877,4487167-4487200,
           4487489-4487629,4487719-4487907,4488027-4488122,
           4488163-4488225,4488588-4489097
          Length = 630

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 40/109 (36%), Positives = 55/109 (50%), Gaps = 25/109 (22%)
 Frame = +3

Query: 3   GSGKTLAYILPAI----------VHINNQPP-----IRRGDG----------PIALVLAP 107
           GSGKTLAY+LP +          + INN  P     +RR +           P A+VL P
Sbjct: 157 GSGKTLAYLLPLVQIEIENTYRLLPINNGVPANQKLLRRDEAMLGMSMKPRRPRAVVLCP 216

Query: 108 TRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           TREL +Q+ +VA    H +  R+T V GG+  R Q   L   V++V+ T
Sbjct: 217 TRELTEQVFRVAKSISHHARFRSTMVSGGSRIRPQEDSLNMPVDMVVGT 265



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 29/75 (38%), Positives = 43/75 (57%), Gaps = 8/75 (10%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR------PDR--QTLM 412
           GR++D ++ G        YLVLDEAD M D GF P IRK +  ++       D+  QT++
Sbjct: 267 GRILDHIKDGNMVYGDIKYLVLDEADTMFDQGFGPDIRKFLAPLKNRAAKPGDQGFQTVL 326

Query: 413 WSATWPKEVKKLAED 457
            +AT  K V+KL ++
Sbjct: 327 VTATMTKAVQKLIDE 341


>07_03_1392 -
           26238885-26239007,26239137-26239235,26239636-26239720,
           26239825-26240028,26240360-26240682,26241904-26242575
          Length = 501

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 34/84 (40%), Positives = 43/84 (51%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP I+H   + P     G  AL LAPTRELA Q+ +     G    +R   
Sbjct: 124 GSGKTAAFALP-ILHRLGEDPY----GVAALALAPTRELAAQLAEQFRALGAPLGLRCLA 178

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG     QA+ L R   +V+AT
Sbjct: 179 AIGGFDSLGQAKGLARRPHVVVAT 202



 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 23/51 (45%), Positives = 32/51 (62%)
 Frame = +2

Query: 302 RCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAE 454
           R  +LVLDEADR+LD+ FE  +R I   +   RQT ++SAT    ++ L E
Sbjct: 222 RTKFLVLDEADRVLDINFEEDLRVIFGSLPKKRQTFLFSATISDNLRSLLE 272


>06_03_1284 -
           28988287-28988922,28989335-28989765,28989850-28989956,
           28990066-28990136
          Length = 414

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 27/55 (49%), Positives = 32/55 (58%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           ALVLAPTRELAQQI++V    G    V+     GG   RE  R L  GV +V+ T
Sbjct: 112 ALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGT 166



 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 34/118 (28%), Positives = 51/118 (43%), Gaps = 2/118 (1%)
 Frame = +2

Query: 176 HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGF 355
           H CV   S +     L  G        GR+ D L + +         VLDEAD ML  GF
Sbjct: 141 HACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGF 200

Query: 356 EPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + QI  I + +    Q  ++SAT P E  ++   ++   ++I +    L L  I  F+
Sbjct: 201 KDQIYDIFQLLPSKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFY 258


>01_05_0296 +
           20567259-20567386,20568895-20569123,20569205-20569436,
           20569583-20569701,20570321-20570377,20570455-20570639,
           20571416-20571560,20571630-20571713,20571798-20571861,
           20571889-20571932
          Length = 428

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 21/78 (26%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++    +   +L+   + +LDE D+MLD +     +++I +    D+Q +M+SAT  K
Sbjct: 165 GRILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK 224

Query: 434 EVKKLAEDYLGDYIQINI 487
           E++ + + ++ D ++I +
Sbjct: 225 EIRPVCKKFMQDPMEIYV 242



 Score = 29.1 bits (62), Expect = 3.4
 Identities = 25/74 (33%), Positives = 34/74 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G GKT  ++L ++  I+   P+    G  ALVL  TRELA QI      F          
Sbjct: 83  GMGKTAVFVLSSLQQID---PVAGQVG--ALVLCHTRELAYQICHEFERFSKYLPEVKVA 137

Query: 183 VFGGAPKREQARDL 224
           VF G    ++ +DL
Sbjct: 138 VFYGGVHIKKHKDL 151


>01_05_0295 +
           20537147-20537291,20539111-20539283,20539365-20539596,
           20539743-20539861,20540480-20540536,20540615-20540799,
           20542252-20542396,20542463-20542546,20542634-20542697,
           20542799-20542809
          Length = 404

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 21/78 (26%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD-MGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GR++    +   +L+   + +LDE D+MLD +     +++I +    D+Q +M+SAT  K
Sbjct: 152 GRILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK 211

Query: 434 EVKKLAEDYLGDYIQINI 487
           E++ + + ++ D ++I +
Sbjct: 212 EIRPVCKKFMQDPMEIYV 229



 Score = 29.1 bits (62), Expect = 3.4
 Identities = 25/74 (33%), Positives = 34/74 (45%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G GKT  ++L ++  I+   P+    G  ALVL  TRELA QI      F          
Sbjct: 70  GMGKTAVFVLSSLQQID---PVAGQVG--ALVLCHTRELAYQICHEFERFSKYLPEVKVA 124

Query: 183 VFGGAPKREQARDL 224
           VF G    ++ +DL
Sbjct: 125 VFYGGVHIKKHKDL 138


>07_03_1500 +
           27001842-27002058,27002144-27002283,27002458-27002549,
           27002680-27002776,27002871-27002951,27003031-27003263,
           27003876-27004070,27004149-27004239,27004324-27004446,
           27004542-27004692,27005060-27005262
          Length = 540

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI-RPDRQTLMWSATWPKE 436
           RL   ++K   +L R  YLVLDE+D++ ++GF   I  +++    P     ++SAT P  
Sbjct: 273 RLDHAVQKRDLDLSRVEYLVLDESDKLFELGFVEVIDSVVKACSNPSIIRSLFSATLPDS 332

Query: 437 VKKLAEDYLGDYIQINIG 490
           ++ LA   + D +++ +G
Sbjct: 333 IETLARTIMHDAVRVIVG 350



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 20/42 (47%), Positives = 29/42 (69%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 128
           GSGKTLA++ P ++ I  +P  +  +G  A++L PTRELA Q
Sbjct: 193 GSGKTLAFLFPILMKI--KPGSK--EGVKAVILCPTRELAAQ 230


>02_01_0381 - 2764331-2764342,2768966-2769907
          Length = 317

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 9/87 (10%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQP---PIRRGDGPIALVLAPTRELAQQ----IQQVAADFGHT 161
           GSGKTL ++LP I+    +    PI  G+GP  +++ P+RELA+Q    I+Q        
Sbjct: 229 GSGKTLVFVLPLIMVALQEEMMMPIVPGEGPFGMIICPSRELAKQTYDVIEQFLVPLKEA 288

Query: 162 SY--VRNTCVFGGAPKREQARDLERGV 236
            Y  +R     GG   R Q   +++G+
Sbjct: 289 GYPEIRPLLCIGGVDMRAQLDVVKKGL 315


>02_05_0064 -
           25529630-25531440,25531663-25531673,25533113-25533198,
           25533412-25534259,25535385-25535736
          Length = 1035

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 29/89 (32%), Positives = 44/89 (49%), Gaps = 7/89 (7%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI------NNQPPIRRGDGPIALVLAPTRELAQQI-QQVAADFGHT 161
           GSGKTLAY+LP +  I        Q    +  G  A+++AP+REL  QI ++V    G  
Sbjct: 640 GSGKTLAYLLPILSEIGPLKRPTEQDSSDKRSGVEAVIVAPSRELGMQIVREVEKILGPN 699

Query: 162 SYVRNTCVFGGAPKREQARDLERGVEIVI 248
                  + GGA +  Q   L++   I++
Sbjct: 700 DKRLVQQLVGGANRSRQEEALKKNKPIIV 728



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 18/104 (17%)
 Frame = +2

Query: 257  GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI---------------- 388
            GR+ +    G  +   C +LVLDE D++L   +   + +I+E +                
Sbjct: 733  GRISEISAAGKLHTHSCRFLVLDEVDQLLSFNYREDMHRILEHVGRKSGTSSRDILGPLA 792

Query: 389  -RPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGS-LQLSAIT 514
             R +RQT++ SAT P  V + A  +  D + +   S + L +IT
Sbjct: 793  RRSERQTILVSATIPFSVIRAARSWGHDPVLVRAMSVVPLESIT 836


>03_02_0189 - 6253659-6255380
          Length = 573

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 7/89 (7%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHIN--NQPPIRRG----DGPIALVLAPTRELAQQI-QQVAADFGHT 161
           GSGKTLAY+LP +  I    +P  + G     G  A+++AP+REL  QI ++V    G  
Sbjct: 178 GSGKTLAYLLPILSEIGPLKRPTEQDGSDKRSGVEAVIVAPSRELGMQIVREVEKILGPN 237

Query: 162 SYVRNTCVFGGAPKREQARDLERGVEIVI 248
                  + GGA +  Q   L++   +++
Sbjct: 238 DKRLVQQLVGGANRSRQEEALKKNKPLIV 266



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 18/104 (17%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI---------------- 388
           GR+ +    G  +   C +LVLDE D++L   +   + +I+E +                
Sbjct: 271 GRISEISAGGKLHTHGCRFLVLDEVDQLLSFNYREDMHRILEHVGRKSGTSSRDILGPLA 330

Query: 389 -RPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGS-LQLSAIT 514
            R +RQT++ SAT P  V + A  +  D + +   S + L +IT
Sbjct: 331 RRSERQTILVSATIPFSVIRAARSWGHDPVLVRAMSVVPLDSIT 374


>03_05_0997 +
           29565311-29565664,29566134-29566298,29566572-29566661,
           29566763-29566891,29568141-29568272,29568904-29568969,
           29569326-29569505,29569664-29569693,29569744-29569839,
           29569959-29570096,29571060-29571142,29571447-29571484,
           29571568-29571788,29572491-29572538
          Length = 589

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAI---VHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAA 146
           GSGKT AY+LP +   + ++ +  IR+   P   +L PTREL QQ+   A+
Sbjct: 130 GSGKTFAYLLPMLHELLKLSAEGRIRKS-APNVFILVPTRELCQQVHNEAS 179


>04_04_0476 -
           25508952-25509004,25509245-25509326,25509453-25509611,
           25509702-25509767,25509898-25510067,25510172-25510262,
           25510331-25510410,25510887-25511003,25511092-25511218,
           25511685-25511865,25511978-25512366,25512959-25513135,
           25513306-25513500,25513844-25514031,25514192-25514500,
           25514592-25514637
          Length = 809

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 32/99 (32%), Positives = 48/99 (48%), Gaps = 15/99 (15%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPP----IRRGD----------GPI-ALVLAPTRELAQQIQQ 137
           GSGKTLA+ LP +  +  +      + R D           P+ AL+L PTRELA+Q+  
Sbjct: 190 GSGKTLAFGLPILQRLLEEQEKAMRLSREDESTQDENSRESPLRALILTPTRELAKQVCD 249

Query: 138 VAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
              +      ++   + GG    +Q R L+R  EIV+ T
Sbjct: 250 HLKEAAKFLRIQVVPIVGGLSMEKQERLLKRKPEIVVGT 288



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 3/47 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRC---TYLVLDEADRMLDMGFEPQIRKIIEQI 388
           GRL + +  G  +L +    ++ VLDEADRM++ G   +++ IIE +
Sbjct: 290 GRLWELMSTGNQHLIKLHSLSFFVLDEADRMIERGHFHELQSIIEML 336


>01_07_0333 -
           42813789-42814073,42814229-42814315,42815083-42815172,
           42815555-42815623,42815859-42815888,42816060-42816164,
           42816454-42816549,42816647-42816760,42816862-42816955,
           42817027-42817190
          Length = 377

 Score = 36.7 bits (81), Expect = 0.017
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPI-ALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           GSGKTLAY+L     I+       G   + ALV+ PTREL  Q+ +VA      +     
Sbjct: 88  GSGKTLAYLLSVFSAIDF------GRSSVQALVVVPTRELGMQVTKVARILAAKACTVMA 141

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
            + GG  +R+++        I++AT
Sbjct: 142 LLDGGMLRRQKSWVKAEPPAIIVAT 166


>03_01_0059 +
           484305-484617,484919-485406,485608-486092,486185-486461,
           486495-486626,486721-486893,486982-487204
          Length = 696

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 4/47 (8%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQ--PPIRRGD--GPIALVLAPTRELAQQI 131
           GSGKTLAY+ P + ++  +    + R     P  +VL PT ELA Q+
Sbjct: 287 GSGKTLAYLCPVVQNLRKEEVEGLHRSSPRNPRVVVLTPTAELASQV 333


>02_05_1067 -
           33858215-33858321,33858422-33858527,33859014-33859218,
           33859463-33859650,33859780-33859957,33860201-33860298,
           33860619-33860873,33861002-33861236,33861846-33861973
          Length = 499

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 21/46 (45%), Positives = 29/46 (63%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQV 140
           GSGKTLAY LP +  +      R+     ALV+ PTR+LA Q+++V
Sbjct: 84  GSGKTLAYALPIVQML----ATRKVRCLRALVVLPTRDLALQVKEV 125



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMW 415
           GRL+D +   KG + L+   YLV+DE DRML   ++  +  +I+  R   Q   W
Sbjct: 186 GRLMDHISMTKGFS-LEHLQYLVVDETDRMLREAYQSWLPTVIQLTRSSDQNHSW 239


>02_02_0099 +
           6768115-6768285,6769950-6770034,6770501-6770628,
           6771429-6771465,6773108-6774193,6774337-6774447,
           6774701-6774817,6774818-6775120,6776092-6776513,
           6776645-6777274
          Length = 1029

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +3

Query: 90  ALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           ALVL PT +LA + Q V    G     +     GG    E  + L  GV++ + T
Sbjct: 730 ALVLVPTHDLAHETQNVIGVLGQFLSAKAHAFCGGTSAHEDQQILSTGVQVAVGT 784


>03_01_0399 +
           3097878-3098141,3098254-3098547,3098659-3098886,
           3099148-3099224,3099501-3099540,3099737-3099802,
           3100305-3100706,3100777-3100888,3101445-3101530,
           3101607-3101672
          Length = 544

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 20/67 (29%), Positives = 32/67 (47%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT  ++L  +  ++    + +     A+ + PTRELAQQ + V    G  + +   C
Sbjct: 150 GSGKTTCFVLGMLSRVDPNRKVTQ-----AICICPTRELAQQNKSVLMRMGKFTGITCAC 204

Query: 183 VFGGAPK 203
               A K
Sbjct: 205 AIPPAQK 211


>11_04_0017 +
           12297539-12297697,12298191-12298229,12298457-12298825,
           12298921-12299058
          Length = 234

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = -1

Query: 423 VADHIKVCLSGRICSMIFLICGSNPISN 340
           +A  ++  L  R+C +I+  CG +P SN
Sbjct: 90  IARKVRDILPSRLCDLIYEDCGDSPTSN 117


>06_03_0547 + 22001831-22002304
          Length = 157

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 16/69 (23%), Positives = 30/69 (43%)
 Frame = +3

Query: 12  KTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFG 191
           +++ Y   A+ H N    +  G G +   L     ++  I    AD+GH +++      G
Sbjct: 11  QSVMYAEAALEHYNAALVVEGGGGGVVNELVRAI-ISGVIITCRADYGHVNFIARAAASG 69

Query: 192 GAPKREQAR 218
           G   R++ R
Sbjct: 70  GGTLRQEER 78


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,722,297
Number of Sequences: 37544
Number of extensions: 395622
Number of successful extensions: 1097
Number of sequences better than 10.0: 57
Number of HSP's better than 10.0 without gapping: 955
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1053
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1721314888
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -