SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120007.Seq
         (661 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_08_0092 - 28307180-28307380,28307471-28307936,28308008-283081...    34   0.12 
01_06_1113 + 34613668-34614075,34614781-34614970,34615264-346153...    33   0.20 
09_02_0057 - 3697255-3698116,3698191-3698351,3698442-3698636,369...    33   0.27 
04_04_0432 + 25157722-25157950,25158045-25158659,25159298-251593...    33   0.27 
01_05_0471 + 22535477-22535609,22535714-22535808,22535929-225360...    31   0.61 
04_04_1416 - 33411900-33412148,33412735-33412854,33412986-334132...    31   1.1  
04_01_0283 + 3768732-3768792,3769235-3769876,3769907-3770076,377...    31   1.1  
04_01_0308 + 4188726-4190351                                           30   1.4  
06_01_0584 - 4178391-4178732,4178854-4178915,4180361-4180481,418...    29   2.5  
06_01_0007 + 130582-131544,132187-132264,132615-132732,133228-13...    29   2.5  
05_03_0500 + 14740454-14740467,14740831-14741098                       29   2.5  
04_04_1615 + 34793511-34793660,34794013-34794070,34794163-347944...    29   2.5  
04_01_0301 + 4016588-4016627,4016715-4018837                           29   2.5  
01_01_0853 + 6658237-6658531,6658683-6658823,6658969-6659238,665...    29   2.5  
12_02_0219 + 15822050-15824896                                         29   3.3  
07_03_1096 + 23931862-23931931,23932406-23932549,23932888-239329...    29   3.3  
06_03_1384 + 29786028-29786657,29788581-29788711,29788987-297890...    29   3.3  
05_06_0263 + 26752759-26754393                                         29   3.3  
05_04_0287 + 19837262-19837552,19837672-19837971,19838120-19838212     29   3.3  
04_03_0742 + 19200045-19200053,19200158-19200437,19201331-192015...    29   3.3  
07_01_1131 - 10510404-10511000                                         29   4.3  
07_01_1122 - 10359014-10359127,10359686-10359769,10360375-10361331     29   4.3  
03_06_0554 + 34691050-34691242,34691327-34691394,34691754-34692275     29   4.3  
02_05_0271 + 27342468-27343577                                         29   4.3  
10_01_0076 - 987092-987671,987747-987812,988201-988363,988467-98...    28   5.7  
09_06_0374 + 22649455-22650024,22650085-22650637,22650812-226511...    28   5.7  
06_01_0641 - 4652380-4653771,4653850-4654521,4654536-4654707,465...    28   5.7  
04_03_0581 - 17496260-17496724                                         28   5.7  
03_05_0994 + 29541109-29542527                                         28   5.7  
02_05_1007 + 33452774-33452993,33453028-33453122,33453208-334533...    28   5.7  
09_01_0076 + 1105331-1105453,1106559-1106705,1107046-1107195,110...    28   7.6  
08_02_1429 + 27040293-27040523,27041618-27041739,27042290-270423...    28   7.6  
06_01_0293 - 2139421-2139600,2139716-2140471,2140830-2140935,214...    28   7.6  
05_04_0002 + 17031662-17032264                                         28   7.6  
05_01_0455 - 3614011-3614503,3615007-3615072,3615154-3615347,361...    28   7.6  
04_01_0505 + 6599181-6599249,6599537-6599632,6599931-6599962,660...    28   7.6  
04_01_0123 - 1283197-1283292,1283330-1284439,1284790-1285177,128...    28   7.6  
03_05_0003 - 19430085-19430210,19430902-19431060,19431269-194313...    28   7.6  
01_06_1713 - 39359558-39359590,39360000-39360074,39360437-393606...    28   7.6  
01_02_0104 + 11163634-11163691,11163929-11164193,11165041-111651...    28   7.6  

>11_08_0092 -
           28307180-28307380,28307471-28307936,28308008-28308117,
           28308206-28308493,28309024-28309059
          Length = 366

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 4/76 (5%)
 Frame = +2

Query: 17  DFWHGARYSRFDDKQSPEDGR--VQGHDGAADGP-ERERPVHHRGGRDRQPGRHHGG-DE 184
           D W G  Y   DD+Q    G+  V     A  G    E  V   G ++ QPG+HHG   +
Sbjct: 61  DRWKGLAYDISDDQQDITRGKGLVDSLFQAPMGDGTHEARVPQPGSQNVQPGQHHGHISK 120

Query: 185 DRVRLPGTTSPKFEVD 232
           + ++LP      F+ D
Sbjct: 121 NLMKLPNIQGKSFQCD 136


>01_06_1113 +
           34613668-34614075,34614781-34614970,34615264-34615372,
           34615822-34615912,34615948-34616076,34616306-34616804,
           34617154-34617251
          Length = 507

 Score = 33.1 bits (72), Expect = 0.20
 Identities = 16/56 (28%), Positives = 26/56 (46%)
 Frame = +2

Query: 86  GHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSS 253
           G  G   G    RP+ + GG DR      GG+ +  ++     P+F  + GE K++
Sbjct: 105 GGSGHGTGAGAPRPMLNGGGNDRNSSAGKGGEVNHTKIKPDGIPRFTSENGERKNT 160


>09_02_0057 -
           3697255-3698116,3698191-3698351,3698442-3698636,
           3698728-3699126,3699208-3699477,3700102-3700695
          Length = 826

 Score = 32.7 bits (71), Expect = 0.27
 Identities = 27/92 (29%), Positives = 36/92 (39%), Gaps = 2/92 (2%)
 Frame = +2

Query: 5   HRCLDFWHGARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDE 184
           HR  D  H  R+   DD +  + G      G  D  +R R  HHR   +    R HG   
Sbjct: 18  HRSRDDHHRRRHDADDDHRRHKRG-----GGGDDDDDRRRRRHHRDDEEESRSRRHGHHR 72

Query: 185 D--RVRLPGTTSPKFEVDAGEYKSSFSKQTSL 274
           D  R  L  + SP       E  SS + + S+
Sbjct: 73  DGGRRSLSPSESPPPPAAKRERSSSRAPRDSV 104


>04_04_0432 +
           25157722-25157950,25158045-25158659,25159298-25159380,
           25159906-25159979,25160101-25160151,25160295-25160371,
           25160856-25161595
          Length = 622

 Score = 32.7 bits (71), Expect = 0.27
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 2/86 (2%)
 Frame = +2

Query: 53  DKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPG--TTSPKFE 226
           +  S E+ RV    GA DG    + +   G R     R   G ED   + G      K +
Sbjct: 245 ESSSSENKRVDSPGGAVDGAVPRKSIDTFGQRT-SIYRGIDGQEDMKLICGIIAVGEKAK 303

Query: 227 VDAGEYKSSFSKQTSLIEHMHNQEHL 304
           V  G+  S++ K+   ++HM  QE++
Sbjct: 304 VARGDRMSNYEKELEEMKHMTRQEYI 329


>01_05_0471 +
           22535477-22535609,22535714-22535808,22535929-22536050,
           22536165-22536702,22536774-22538105
          Length = 739

 Score = 31.5 bits (68), Expect = 0.61
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +2

Query: 374 AEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           AEIA AL  +HQ   E    RDL+PA + L+ N +
Sbjct: 533 AEIATALLFLHQTKPEPLVHRDLKPANILLDRNYV 567


>04_04_1416 -
           33411900-33412148,33412735-33412854,33412986-33413235,
           33413998-33414131
          Length = 250

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 1/50 (2%)
 Frame = +2

Query: 35  RYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPG-RHHGGD 181
           R  R DD    +DG   G DG  DG       HH  G D   G  HHGGD
Sbjct: 177 RRRRRDDDGGGDDGP-DGGDGGGDGGG-----HHEHGGDHGGGWHHHGGD 220


>04_01_0283 +
           3768732-3768792,3769235-3769876,3769907-3770076,
           3770134-3770511,3770602-3770991
          Length = 546

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 22/90 (24%), Positives = 38/90 (42%), Gaps = 3/90 (3%)
 Frame = +2

Query: 206 TTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAE-- 379
           TT+  FEV+  E           +E +   + LVE +   L+  ++TA Q  +  + E  
Sbjct: 316 TTTKAFEVEKAEILKELEDLRRKVEEIQTNKDLVEGENDKLRLDVLTAQQKQSILEVEAN 375

Query: 380 -IAKALSVVHQDLDEADKDRDLEPAKVSLE 466
            +   L  + +  +   K  D E AK+  E
Sbjct: 376 NLKMELGALVEAKEATTKAFDAEKAKIMKE 405


>04_01_0308 + 4188726-4190351
          Length = 541

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 4/90 (4%)
 Frame = +2

Query: 209 TSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAK 388
           T+  F+V+              +E +  ++ LVE +    +  ++T  Q  +KS A+ AK
Sbjct: 312 TAKAFDVEKAGILKELEDPKRKVEEIQAKKDLVERENDKFQLEVLTGEQKQSKSKAK-AK 370

Query: 389 ALSVVHQDLDEAD----KDRDLEPAKVSLE 466
           +L V    L EA     K  D+E AK+  E
Sbjct: 371 SLKVELSALVEAKEATAKAFDVEKAKIMKE 400


>06_01_0584 -
           4178391-4178732,4178854-4178915,4180361-4180481,
           4180592-4180732,4180830-4180959,4182306-4182436,
           4182528-4182601,4182680-4182741,4183135-4183209,
           4184658-4184760,4184835-4184991,4185549-4185743,
           4186204-4186282,4186697-4186806,4187249-4187374,
           4187475-4187541,4187622-4187791,4187880-4188018,
           4188361-4188522,4188672-4188772,4188852-4188994,
           4189438-4189537,4190364-4190414,4191062-4191169,
           4191279-4191494,4191585-4191721,4191820-4191915,
           4192017-4192234,4192764-4192925,4193006-4193163,
           4194221-4194379
          Length = 1364

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 30/112 (26%), Positives = 47/112 (41%), Gaps = 11/112 (9%)
 Frame = +2

Query: 137 RGGRDRQPGRHHGGDEDRVRLPGTTSPKFE----VDAGEYKSSFSKQTSLIEHMHNQEHL 304
           RGG  +   RH  G  +R+      SP  E    +D  E K   S++TS  E    ++ +
Sbjct: 30  RGGGGKGRDRHSDGPTERIEREDAVSPLTEMEKILDCEETKPDASEETSSSESGSKKKPV 89

Query: 305 VE--TQMKDLKRLIVT-ASQS----SAKSDAEIAKALSVVHQDLDEADKDRD 439
                + K +  L  T  S+S    +AK    +   L+  H+ +D  DK  D
Sbjct: 90  KRYLIKWKGISHLHCTWVSESEYLETAKIYPRLKTRLNNFHKQMDSTDKSDD 141


>06_01_0007 +
           130582-131544,132187-132264,132615-132732,133228-133271,
           133389-133448,133536-133588,133671-133837,133963-134167,
           134989-135046,135225-135281,135363-135608,135938-136002,
           136090-136158,136238-136331,136467-136607,137159-137304,
           137452-138110,138222-138335,138406-138560
          Length = 1163

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
 Frame = +2

Query: 272 LIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLD---EADKDRDL 442
           +I   H  + L      DL+  ++   ++S   D  ++ A+ ++HQ  D   E    RDL
Sbjct: 639 IIRKKHEMKGLSMDTNTDLRWRLLAGRKASEDGDLLLSAAVPIIHQSFDPIIEVQSGRDL 698

Query: 443 EPAKVS 460
            P  V+
Sbjct: 699 IPEMVN 704


>05_03_0500 + 14740454-14740467,14740831-14741098
          Length = 93

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 2/60 (3%)
 Frame = +2

Query: 26  HGARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHH--GGDEDRVRL 199
           HGA       +Q  +D  V  H G  +G  R   V    G+D   G+HH  GGD  R R+
Sbjct: 33  HGASGGSGVARQKGKDFTVGNHHGVGEGRLRCSVVE--AGKDLAVGKHHGAGGDWRRSRI 90


>04_04_1615 +
           34793511-34793660,34794013-34794070,34794163-34794410,
           34794485-34794601,34795309-34795369,34795860-34795954,
           34796048-34796122,34796316-34796401,34796529-34796578,
           34796667-34796707,34796784-34796948,34797204-34797271,
           34797362-34797422,34797878-34798393
          Length = 596

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%)
 Frame = +2

Query: 110 PERERPVHHRGGRD--RQPGRHHGGDEDRVRLPGTTSPKFEVDAGE 241
           P R R   H  G+D  R+  +H GGD+  +R   +T    + D G+
Sbjct: 436 PRRIRETMHGWGKDARRRRKKHRGGDDSTIRTETSTVCSLDDDDGD 481


>04_01_0301 + 4016588-4016627,4016715-4018837
          Length = 720

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 3/89 (3%)
 Frame = +2

Query: 209 TSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIA- 385
           T+  F V+  E           ++ +   ++LVE +   L+  + TA Q  + S+AE+  
Sbjct: 545 TAKAFNVEKAEILKELEDLKRKVQEIQANKYLVEGENDKLRLDVSTAEQKESISEAEVKR 604

Query: 386 --KALSVVHQDLDEADKDRDLEPAKVSLE 466
             K L  + +  +   K  D E  K+  E
Sbjct: 605 LWKILDALMEAKEVTTKAFDAEKEKIMKE 633


>01_01_0853 +
           6658237-6658531,6658683-6658823,6658969-6659238,
           6659324-6659463,6659563-6659709,6660739-6661320
          Length = 524

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = +2

Query: 254 FSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSS--AKSDAEIAKALSVVHQDLDEAD 427
           +S QTSL++H+H     ++  + DL   + TASQ    AK   +I++ +S  +Q  +   
Sbjct: 367 WSLQTSLLKHVHVSTERLQHSI-DLHSYLFTASQEDNYAKPQLKISRVVSFKNQSGEPES 425

Query: 428 K 430
           K
Sbjct: 426 K 426


>12_02_0219 + 15822050-15824896
          Length = 948

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 17/68 (25%), Positives = 34/68 (50%)
 Frame = +2

Query: 263 QTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDRDL 442
           Q SL +H+++ E ++  Q +  +        S+ K   ++  AL  +H D ++     D+
Sbjct: 745 QGSLDKHLYDPEKILTWQQR-YQIKFANLFNSTDKIVLDLGSALLYLHHDCEKCIVHGDI 803

Query: 443 EPAKVSLE 466
           +PA V L+
Sbjct: 804 KPANVMLD 811


>07_03_1096 +
           23931862-23931931,23932406-23932549,23932888-23932986,
           23933422-23933498,23933813-23933921,23934973-23935301,
           23935838-23935930
          Length = 306

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = -1

Query: 289 VHVFDKGSLLAER*FIFSCINFKFW 215
           +H FD G L  +  F+   +NF FW
Sbjct: 46  IHYFDDGPLTVQYLFVLDALNFCFW 70


>06_03_1384 +
           29786028-29786657,29788581-29788711,29788987-29789028,
           29789383-29789441,29789774-29790070,29790180-29790289,
           29790966-29791070,29791201-29791263,29791766-29791933,
           29792111-29792248
          Length = 580

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 5/95 (5%)
 Frame = +2

Query: 65  PEDGRVQ---GHDGAADGPERERPVHHRGGRDRQPGRHH--GGDEDRVRLPGTTSPKFEV 229
           PE+G V    G  GAADG E ERP+    G  +  G  +  G +  R     T S    V
Sbjct: 134 PEEGGVGAGGGGGGAADGAETERPLDKTFGFSKNFGAKYELGKEVGRGHFGHTCSA--VV 191

Query: 230 DAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKR 334
             GEYK     QT  ++ +   +      ++D++R
Sbjct: 192 KKGEYKG----QTVAVKIIAKAKMTTAISIEDVRR 222


>05_06_0263 + 26752759-26754393
          Length = 544

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 311 TQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEAD 427
           T M+ LK+L +  ++        IAK+L   HQDL E D
Sbjct: 409 TAMQSLKKLTLAENELKDDGAVVIAKSLEDGHQDLKELD 447


>05_04_0287 + 19837262-19837552,19837672-19837971,19838120-19838212
          Length = 227

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 2/45 (4%)
 Frame = +2

Query: 311 TQMKDLKRLIVTASQSSAKSDAE--IAKALSVVHQDLDEADKDRD 439
           T ++ LK+L  T +++  K D    IAKAL   HQDL E D  ++
Sbjct: 147 TTLQSLKKL--TLAENGLKDDGAVVIAKALEDGHQDLKELDVSKE 189


>04_03_0742 +
           19200045-19200053,19200158-19200437,19201331-19201545,
           19201705-19201792,19202277-19202842
          Length = 385

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 16/69 (23%), Positives = 29/69 (42%), Gaps = 4/69 (5%)
 Frame = +2

Query: 50  DDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTT----SP 217
           D+K+  +DG+ +G +G  D  + E+     GG      +    ++D   +         P
Sbjct: 267 DEKEEKKDGKEEGGNGGGDEKKEEKEKEKEGGNADGEEKDKDKEKDPAAIAAANLYLHYP 326

Query: 218 KFEVDAGEY 244
           +F   AG Y
Sbjct: 327 RFAFPAGYY 335


>07_01_1131 - 10510404-10511000
          Length = 198

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 15/41 (36%), Positives = 20/41 (48%)
 Frame = +2

Query: 83  QGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPG 205
           +G  G       ERP  H GG   + GR   G++D V +PG
Sbjct: 58  EGPTGEIPARRMERPARH-GGVPAKYGRRLDGEDDGVLVPG 97


>07_01_1122 - 10359014-10359127,10359686-10359769,10360375-10361331
          Length = 384

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 13/33 (39%), Positives = 15/33 (45%)
 Frame = +2

Query: 62  SPEDGRVQGHDGAADGPERERPVHHRGGRDRQP 160
           SP  G +  H  A    +R RP   RGG  R P
Sbjct: 68  SPNGGALSTHHAAQPRRQRSRPRRQRGGAGRPP 100


>03_06_0554 + 34691050-34691242,34691327-34691394,34691754-34692275
          Length = 260

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 21/66 (31%), Positives = 26/66 (39%)
 Frame = +2

Query: 5   HRCLDFWHGARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDE 184
           H CL    GAR   FDD+++        HD      ER  P         Q G+H GG  
Sbjct: 89  HACLT--DGARRRAFDDERAASYCAAC-HDRFRHRAERRTPAAATATGGAQHGKHRGGGG 145

Query: 185 DRVRLP 202
              R+P
Sbjct: 146 GGRRMP 151


>02_05_0271 + 27342468-27343577
          Length = 369

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +3

Query: 12  ASIFGTVLGIAGSTINNHLKMAEFRDMMEQQMARSASVLYTIAGGGTA 155
           AS+FG   G AGS+  + +       M++Q      S++ ++AGGG A
Sbjct: 232 ASVFGG--GFAGSSAPSSIPHGRGTTMVDQGQMHLQSLMNSLAGGGNA 277


>10_01_0076 -
           987092-987671,987747-987812,988201-988363,988467-988548,
           989153-989202,989237-989270,990177-990239,990339-990403,
           990485-990560,991274-991353,991514-991628,991729-991830
          Length = 491

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 15/46 (32%), Positives = 21/46 (45%)
 Frame = +2

Query: 53  DKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDR 190
           ++   E  R + HD   +   +E   HHR  RDR   R  G D +R
Sbjct: 310 ERDRDERTRERSHDRTRERDSKEDRHHHRD-RDRTRDRERGRDRER 354


>09_06_0374 +
           22649455-22650024,22650085-22650637,22650812-22651147,
           22651171-22652605,22652939-22653062
          Length = 1005

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 5/55 (9%)
 Frame = +2

Query: 68  EDGRVQGHDGAADGPERERPVHHRGGR-----DRQPGRHHGGDEDRVRLPGTTSP 217
           E+   +GHDGA  G  R      RGGR     DR PG     D    R  G T P
Sbjct: 286 EERAPKGHDGAG-GSRRGEQSTPRGGRASGSRDRGPGSSRPADARGKRKQGGTPP 339


>06_01_0641 -
           4652380-4653771,4653850-4654521,4654536-4654707,
           4655515-4655690
          Length = 803

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +2

Query: 374 AEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           AEIA  L  +HQ   E    RDL+P  + L+ N +
Sbjct: 583 AEIATGLLFLHQTKPEPLVHRDLKPGNILLDRNYV 617


>04_03_0581 - 17496260-17496724
          Length = 154

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = +2

Query: 65  PEDGRVQGHDGAADG-PERERPVHHRGGRDRQPGRHHG 175
           P    V+G   AA G P R R    RGGR +Q  R HG
Sbjct: 77  PASAHVEGRAVAAGGCPARRRA--ERGGRRQQVARRHG 112


>03_05_0994 + 29541109-29542527
          Length = 472

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +2

Query: 50  DDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQP 160
           DDK    DG V+ +D A++  E E PV  RG   R P
Sbjct: 348 DDKVEAMDGEVEQNDKASE--EEEVPVARRGRARRAP 382


>02_05_1007 +
           33452774-33452993,33453028-33453122,33453208-33453329,
           33453392-33453694,33454657-33454918,33455039-33455140,
           33455931-33457151,33457250-33457342
          Length = 805

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +2

Query: 374 AEIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           AEIA  L  +HQ   E    RDL+P  + L+ N +
Sbjct: 570 AEIATGLLFLHQTKPEPLVHRDLKPGNILLDRNYV 604


>09_01_0076 + 1105331-1105453,1106559-1106705,1107046-1107195,
            1107272-1107531,1107897-1108084,1108187-1108311,
            1108485-1108521,1108802-1108893,1109023-1109133,
            1109242-1109352,1109576-1109669,1109833-1109945,
            1110316-1110411,1110510-1110617,1110665-1110814,
            1110910-1110990,1111205-1111276,1111553-1111646,
            1111759-1111787,1111870-1111967,1112065-1112160,
            1112399-1112620,1113002-1113158,1113472-1113627,
            1113703-1113930
          Length = 1045

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 11/53 (20%), Positives = 26/53 (49%)
 Frame = +2

Query: 224  EVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEI 382
            E++  E K   ++  +++ H  ++    E Q+K  ++  VTA+ S    +  +
Sbjct: 873  EMEIKEMKEQMTELVTILRHSESRRRETEKQLKQREQAAVTATTSPGNGNGSV 925


>08_02_1429 +
           27040293-27040523,27041618-27041739,27042290-27042392,
           27042530-27042620,27042851-27043023,27043379-27043467,
           27044212-27044319,27044408-27044498,27044708-27044797,
           27045587-27045658,27045756-27045849,27045940-27046087,
           27046961-27047222
          Length = 557

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 16/49 (32%), Positives = 19/49 (38%)
 Frame = +2

Query: 38  YSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDE 184
           Y   DD    +DG   G  G +DG E E       G D +     G DE
Sbjct: 22  YDYSDDMGEDDDGSGGGGGGDSDGEEEEEGDEELVGGDYEGREAEGSDE 70


>06_01_0293 -
           2139421-2139600,2139716-2140471,2140830-2140935,
           2140999-2141249,2141342-2141443,2141557-2141876,
           2142350-2142546,2143668-2143786,2143876-2143997,
           2144877-2145081
          Length = 785

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +2

Query: 377 EIAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           E+A AL  +H    E    RDL+PA + L+ N +
Sbjct: 533 EVATALMFLHSSKPEPIIHRDLKPANILLDRNLV 566


>05_04_0002 + 17031662-17032264
          Length = 200

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 14/47 (29%), Positives = 15/47 (31%)
 Frame = +2

Query: 47  FDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDED 187
           F  K+ P            D  E E         D  PGRHH   ED
Sbjct: 53  FSGKRGPPTSSTSTMASGGDDDEEEGASSSSSSADTSPGRHHQDRED 99


>05_01_0455 -
           3614011-3614503,3615007-3615072,3615154-3615347,
           3615562-3615657,3615790-3615829,3616729-3616856
          Length = 338

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = +2

Query: 95  GAADGPERERPVHHRGGRDRQPGRHHGGDED 187
           G +D   RER  +   GRD Q G H  GD D
Sbjct: 302 GDSDYLSRERDDYLSRGRDDQNGSHRRGDSD 332


>04_01_0505 +
           6599181-6599249,6599537-6599632,6599931-6599962,
           6601191-6601428,6601852-6601905,6601923-6602130,
           6602353-6602590,6602788-6602962,6603074-6603442
          Length = 492

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +2

Query: 380 IAKALSVVHQDLDEADKDRDLEPAKVSLEPNQI 478
           IA+ L  +H++  +   DRDL+P+ V L+ + I
Sbjct: 252 IARGLLYLHEESSQKIIDRDLKPSNVLLDEDMI 284


>04_01_0123 -
           1283197-1283292,1283330-1284439,1284790-1285177,
           1285523-1287609
          Length = 1226

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 1/68 (1%)
 Frame = +2

Query: 53  DKQSPED-GRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEV 229
           +++ P++ GR + H+   DG  R      R    R PGRH      R R P  + P    
Sbjct: 344 ERRVPDNTGRGRRHNDVDDGDRRRDNSGRRRQDSRDPGRH-----PRNRTPEPSDPSSSS 398

Query: 230 DAGEYKSS 253
            +  + SS
Sbjct: 399 SSASFSSS 406


>03_05_0003 -
           19430085-19430210,19430902-19431060,19431269-19431358,
           19431433-19431603,19431655-19431797,19431831-19431923,
           19431963-19432279,19432819-19432885,19433039-19433204
          Length = 443

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = +2

Query: 140 GGRDRQPGRHHGGDEDRVRLP 202
           GG     G HHG DE+ V +P
Sbjct: 86  GGSKSSGGSHHGSDEEEVTMP 106


>01_06_1713 -
           39359558-39359590,39360000-39360074,39360437-39360662,
           39360792-39360880,39360960-39361053,39361134-39361318,
           39361415-39361582,39361682-39361822,39362327-39362545,
           39362628-39362744,39363154-39363248,39363662-39363743,
           39363864-39363926,39364157-39364216,39364312-39364476,
           39364574-39364759,39364890-39365180,39365262-39365405,
           39365492-39366172,39367045-39367362
          Length = 1143

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 18/74 (24%), Positives = 30/74 (40%)
 Frame = +3

Query: 57  NNHLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAMKTEFAYQEQLAQNLKLMQ 236
           N H K+ E    +EQ++  S   L         S + ++E  KT   Y  +    LK ++
Sbjct: 730 NEHHKLGELVKKLEQELQESKQELKAKQAQYEKSVSTVSELEKTIKTYGSEREGRLKALE 789

Query: 237 ENINHLSASKLPLS 278
             I  L +    +S
Sbjct: 790 RKIKSLKSELQSMS 803


>01_02_0104 +
           11163634-11163691,11163929-11164193,11165041-11165163,
           11165275-11165311,11165320-11165514,11165673-11165792,
           11165979-11166173
          Length = 330

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = +3

Query: 108 ARSASVLYTIAGGGTASRADITEAMKTEFA 197
           + ++ V   + GGG +S +D+TE MK + A
Sbjct: 180 SEASGVGVVVGGGGGSSSSDLTELMKAQIA 209


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,783,575
Number of Sequences: 37544
Number of extensions: 399071
Number of successful extensions: 1799
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 1670
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1790
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1655832080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -