SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_0409 - 20503480-20503678,20504522-20504717,20504805-205048...   128   3e-30
01_01_0745 + 5769150-5769152,5769268-5769375,5769812-5769854,576...   128   3e-30
05_02_0095 + 6564703-6564705,6564848-6564955,6565153-6565195,656...   111   4e-25
02_02_0195 + 7676014-7676094,7676111-7676218,7676307-7676349,767...   111   6e-25
02_02_0196 + 7685933-7685961,7686086-7686284                           64   8e-11
01_01_0582 - 4317216-4317731                                           28   5.2  

>06_03_0409 -
           20503480-20503678,20504522-20504717,20504805-20504847,
           20505632-20505739,20505848-20505850
          Length = 182

 Score =  128 bits (309), Expect = 3e-30
 Identities = 60/83 (72%), Positives = 67/83 (80%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 438
           KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DFYVVL R 
Sbjct: 77  KAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERA 136

Query: 439 GFNVAHRRRKTGKVGFPHRLTKE 507
           G+ VA RRR   +VG  HR+TKE
Sbjct: 137 GYRVARRRRCKSRVGIQHRVTKE 159



 Score =  111 bits (267), Expect = 4e-25
 Identities = 56/80 (70%), Positives = 63/80 (78%)
 Frame = +2

Query: 38  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIR 217
           SE    N MR + ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIR
Sbjct: 3   SEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIR 62

Query: 218 RNEKIAVHCTVRELKQKKSL 277
           RNEKIA + TVR  K  + L
Sbjct: 63  RNEKIACYVTVRGEKAMQLL 82



 Score = 27.9 bits (59), Expect = 6.8
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 480 GISPPPHKGSAMKWFQQKYDG 542
           GI     K  AMKWFQ KY+G
Sbjct: 151 GIQHRVTKEDAMKWFQVKYEG 171


>01_01_0745 +
           5769150-5769152,5769268-5769375,5769812-5769854,
           5769945-5770140,5770836-5771034
          Length = 182

 Score =  128 bits (309), Expect = 3e-30
 Identities = 60/83 (72%), Positives = 67/83 (80%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRP 438
           KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIKYDPS GIYG+DFYVVL R 
Sbjct: 77  KAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERA 136

Query: 439 GFNVAHRRRKTGKVGFPHRLTKE 507
           G+ VA RRR   +VG  HR+TKE
Sbjct: 137 GYRVARRRRCKSRVGIQHRVTKE 159



 Score =  111 bits (266), Expect = 6e-25
 Identities = 56/80 (70%), Positives = 63/80 (78%)
 Frame = +2

Query: 38  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIR 217
           SE    N MR + ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIR
Sbjct: 3   SEKKQANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIR 62

Query: 218 RNEKIAVHCTVRELKQKKSL 277
           RNEKIA + TVR  K  + L
Sbjct: 63  RNEKIACYVTVRGEKAMQLL 82



 Score = 27.9 bits (59), Expect = 6.8
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 480 GISPPPHKGSAMKWFQQKYDG 542
           GI     K  AMKWFQ KY+G
Sbjct: 151 GIQHRVTKEDAMKWFQVKYEG 171


>05_02_0095 +
           6564703-6564705,6564848-6564955,6565153-6565195,
           6565303-6565409,6566310-6566395,6566396-6566594
          Length = 181

 Score =  111 bits (267), Expect = 4e-25
 Identities = 56/80 (70%), Positives = 63/80 (78%)
 Frame = +2

Query: 38  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIR 217
           SE    N MR + ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIR
Sbjct: 3   SEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQSPVFSKARYTVRSFGIR 62

Query: 218 RNEKIAVHCTVRELKQKKSL 277
           RNEKIA + TVR  K  + L
Sbjct: 63  RNEKIACYVTVRGEKAMQLL 82



 Score = 64.9 bits (151), Expect = 5e-11
 Identities = 28/43 (65%), Positives = 33/43 (76%)
 Frame = +1

Query: 379 KYDPSIGIYGLDFYVVLGRPGFNVAHRRRKTGKVGFPHRLTKE 507
           +YDPS GIYG+DFYVVL R G+ VA RRR   +VG  HR+TKE
Sbjct: 116 RYDPSTGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKE 158



 Score = 27.9 bits (59), Expect = 6.8
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 480 GISPPPHKGSAMKWFQQKYDG 542
           GI     K  AMKWFQ KY+G
Sbjct: 150 GIQHRVTKEDAMKWFQVKYEG 170


>02_02_0195 +
           7676014-7676094,7676111-7676218,7676307-7676349,
           7676449-7676648
          Length = 143

 Score =  111 bits (266), Expect = 6e-25
 Identities = 56/80 (70%), Positives = 63/80 (78%)
 Frame = +2

Query: 38  SEDNSKNVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIR 217
           SE    N MR + ++KL LNI VGESGDRLTRA+KVLEQL+GQ PVFSKARYTVRSFGIR
Sbjct: 29  SEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLSGQTPVFSKARYTVRSFGIR 88

Query: 218 RNEKIAVHCTVRELKQKKSL 277
           RNEKIA + TVR  K  + L
Sbjct: 89  RNEKIACYVTVRGEKAMQLL 108



 Score = 68.1 bits (159), Expect = 5e-12
 Identities = 32/41 (78%), Positives = 35/41 (85%)
 Frame = +1

Query: 259 KAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIK 381
           KA ++LE GLKV+EYEL R NFS TG FGFGIQEHIDLGIK
Sbjct: 103 KAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIK 143


>02_02_0196 + 7685933-7685961,7686086-7686284
          Length = 75

 Score = 64.1 bits (149), Expect = 8e-11
 Identities = 28/42 (66%), Positives = 32/42 (76%)
 Frame = +1

Query: 382 YDPSIGIYGLDFYVVLGRPGFNVAHRRRKTGKVGFPHRLTKE 507
           YDPS GIYG+DFYVVL R G+ VA RRR   +VG  HR+TKE
Sbjct: 11  YDPSTGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKE 52



 Score = 27.9 bits (59), Expect = 6.8
 Identities = 12/21 (57%), Positives = 13/21 (61%)
 Frame = +3

Query: 480 GISPPPHKGSAMKWFQQKYDG 542
           GI     K  AMKWFQ KY+G
Sbjct: 44  GIQHRVTKEDAMKWFQVKYEG 64


>01_01_0582 - 4317216-4317731
          Length = 171

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 17/42 (40%), Positives = 20/42 (47%)
 Frame = -3

Query: 219 RRIPKDRTVYLALENTGCCPVSCSNTLAARVSLSPDSPTQMF 94
           RRI ++    + L  TGC P S S   AARV     S  Q F
Sbjct: 98  RRILRENKKRILLCATGCVPASSSAAAAARVPYDAYSYAQNF 139


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,599,397
Number of Sequences: 37544
Number of extensions: 334468
Number of successful extensions: 917
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 895
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 917
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1490248872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -