SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120003.Seq
         (731 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0770 - 5756200-5756741,5756790-5757286,5757356-5757782,575...    31   0.94 
04_03_0632 + 18200844-18200970,18201134-18201190,18201370-182014...    31   1.2  
06_03_1285 - 28993305-28993442,28993559-28993798,28993881-289939...    29   2.9  
05_04_0402 - 20991628-20991755,20992461-20992578,20992670-209927...    29   3.8  
01_07_0137 - 41381294-41382433                                         29   3.8  
09_02_0077 + 3964729-3964734,3965194-3965289,3965744-3973579,397...    29   5.0  
11_01_0607 - 4837257-4837447,4837526-4837631,4837913-4838005,483...    28   6.6  
01_06_1512 + 37881055-37881229,37881388-37881444,37881537-378816...    28   6.6  
05_04_0366 - 20663243-20663388,20663467-20663572,20664275-206643...    28   8.8  
01_06_1567 + 38293612-38293795,38294467-38294523,38294609-382946...    28   8.8  

>06_01_0770 -
           5756200-5756741,5756790-5757286,5757356-5757782,
           5757854-5757911
          Length = 507

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 392 DTPPFYFINTRDNFRDNIAEHVFDMLLERHG 484
           D  P  F+NT D+F   I +H+ + + E+HG
Sbjct: 318 DQCPASFLNTSDDFTARIVDHMVEHIKEQHG 348


>04_03_0632 +
           18200844-18200970,18201134-18201190,18201370-18201460,
           18201545-18201705,18202176-18202303,18202386-18202523,
           18202966-18203058,18203546-18203704
          Length = 317

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544
           FNT V  P++Y  FTIL   +I ++I++K
Sbjct: 239 FNTAVVSPVYYVMFTIL--TIIANMIMYK 265


>06_03_1285 -
           28993305-28993442,28993559-28993798,28993881-28993961,
           28994370-28994429,28994523-28994628,28994861-28994921,
           28995198-28995246,28995475-28995599,28995809-28995947,
           28996432-28996503,28996615-28996742,28997037-28997136,
           28997757-28997897,28998116-28998232,28998505-28998609,
           28999037-28999153
          Length = 592

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 10/34 (29%), Positives = 20/34 (58%)
 Frame = +1

Query: 463 HVTRKTWLV*KLSHCNTAFINSLIVNGFKYNQVD 564
           H+  K W +  + H +T+    + + GFK+N+V+
Sbjct: 553 HIENKGWTIQHVDHKDTSEKEEIRIRGFKFNKVE 586


>05_04_0402 -
           20991628-20991755,20992461-20992578,20992670-20992762,
           20992841-20992978,20993070-20993197,20993270-20993430,
           20993548-20993638,20993731-20993787,20993986-20994139
          Length = 355

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFKPVNDQAV 523
           FNT V  PI+Y  FT L   ++   I+FK  + Q++
Sbjct: 248 FNTAVVSPIYYAMFTSL--TILASAIMFKDWSGQSI 281


>01_07_0137 - 41381294-41382433
          Length = 379

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 2/58 (3%)
 Frame = -1

Query: 314 WPSLVFVSALMTCTVDKLCSK--LQTRTRKCLICSWLADLS*N*TFATR**SPRPQTC 147
           W +L F   +    VD +  K    T +R+  + +W  D S +   ATR   PRP+ C
Sbjct: 182 WTALWFPKWMQHKYVDVVYHKGAFYTASREAAVTAWAPDASSSGLHATRVTEPRPEKC 239


>09_02_0077 + 3964729-3964734,3965194-3965289,3965744-3973579,
            3973665-3973982,3974565-3974763,3974937-3975202,
            3975288-3975574,3976714-3977818,3977900-3978046,
            3978146-3978226,3978315-3978540,3978622-3978761,
            3979539-3979645,3979739-3979841
          Length = 3638

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = -3

Query: 252  TTNSYSKMFDM*LVSRFILKLNFCNSLIEPTSTDLSIN 139
            T  SY K+ +  + S F+L  +    L++P  T+LSIN
Sbjct: 1092 TLQSYCKLLEYCVNSSFLLSPSHNQLLVQPMVTELSIN 1129


>11_01_0607 -
           4837257-4837447,4837526-4837631,4837913-4838005,
           4838405-4838542,4838651-4838778,4838889-4839049,
           4839145-4839235,4841437-4841602
          Length = 357

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544
           FNT V  PI+Y  FT L   ++  +I+FK
Sbjct: 233 FNTAVVSPIYYVMFTSL--TILASVIMFK 259


>01_06_1512 +
           37881055-37881229,37881388-37881444,37881537-37881627,
           37881759-37881919,37882002-37882129,37882215-37882352,
           37882665-37882757,37882858-37882975,37883064-37883194
          Length = 363

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFKPVNDQAVDK 517
           FN  V  PI+Y  FT L   ++   I+FK  + Q+  K
Sbjct: 255 FNAAVVSPIYYAMFTTL--TILASAIMFKDWSGQSASK 290


>05_04_0366 -
           20663243-20663388,20663467-20663572,20664275-20664367,
           20664520-20664657,20664759-20664886,20664996-20665156,
           20665277-20665367,20665460-20665516,20666288-20666444
          Length = 358

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544
           FNT V  PI+Y  FT L   ++  +I+FK
Sbjct: 249 FNTAVVSPIYYTMFTSL--TILASVIMFK 275


>01_06_1567 +
           38293612-38293795,38294467-38294523,38294609-38294699,
           38294799-38294959,38295045-38295172,38295291-38295428,
           38295717-38295809,38298219-38298324,38298393-38298517
          Length = 360

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -3

Query: 630 FNTLVFGPIFYFCFTILAHNVIVDLIVFK 544
           FNT V  PI+Y  FT L   ++  +I+FK
Sbjct: 258 FNTAVVSPIYYTMFTSL--TILASVIMFK 284


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,795,755
Number of Sequences: 37544
Number of extensions: 309959
Number of successful extensions: 805
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 788
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 805
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1921741964
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -