SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120002.Seq
         (725 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0981 + 12917195-12917572,12917661-12917818,12918732-129187...    31   0.93 
01_01_0100 - 755894-756662,757086-757598,758718-761050                 31   1.2  
08_02_1451 - 27192418-27192423,27192424-27193146                       29   3.8  
05_04_0184 - 18855062-18855604,18855889-18856611                       29   3.8  
09_03_0160 - 12915283-12915453,12915546-12915713,12915944-129159...    28   8.7  

>03_02_0981 +
           12917195-12917572,12917661-12917818,12918732-12918765,
           12918942-12919074,12919167-12919221,12919281-12920064,
           12920440-12920769,12920788-12920895,12921259-12921678,
           12921775-12921847,12922291-12922376,12922873-12922992,
           12923086-12923156,12923350-12923449
          Length = 949

 Score = 31.1 bits (67), Expect = 0.93
 Identities = 16/56 (28%), Positives = 29/56 (51%)
 Frame = +3

Query: 234 VLQIDARGEFI*Y*RNSDGTQAAGPYEVKAGGSTTIKFKNVFDSSRMFKIYVDREE 401
           +  ID R  F  +  N+DG+   GP+E    GS+ +  + +F  + + K+  + EE
Sbjct: 339 IKNIDIRSLFPTWRVNNDGSITCGPHEAGGCGSSKLVLRRIFKINWISKLVKNSEE 394


>01_01_0100 - 755894-756662,757086-757598,758718-761050
          Length = 1204

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 14/45 (31%), Positives = 27/45 (60%)
 Frame = +3

Query: 297  AAGPYEVKAGGSTTIKFKNVFDSSRMFKIYVDREEFYVKTMFETI 431
            A+G Y++K  G+T  +   + ++   F++Y+  +EF V+T  E I
Sbjct: 1105 ASGSYKLKTVGNTYREILAIINAINAFRLYLGFKEFTVRTDCEAI 1149


>08_02_1451 - 27192418-27192423,27192424-27193146
          Length = 242

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 13/45 (28%), Positives = 26/45 (57%)
 Frame = +3

Query: 297 AAGPYEVKAGGSTTIKFKNVFDSSRMFKIYVDREEFYVKTMFETI 431
           A+G Y++K   +T  +   + ++   F++Y+  +EF V+T  E I
Sbjct: 143 ASGSYKLKTVNNTDREIMAIINAINAFRLYLGFKEFTVRTDCEAI 187


>05_04_0184 - 18855062-18855604,18855889-18856611
          Length = 421

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 13/45 (28%), Positives = 26/45 (57%)
 Frame = +3

Query: 297 AAGPYEVKAGGSTTIKFKNVFDSSRMFKIYVDREEFYVKTMFETI 431
           A+G Y++K   +T  +   + ++   F++Y+  +EF V+T  E I
Sbjct: 143 ASGSYKLKTVNNTDREIMAIINAINAFRLYLGFKEFTVRTDCEAI 187


>09_03_0160 -
           12915283-12915453,12915546-12915713,12915944-12915957,
           12916051-12916153,12917359-12917445,12917741-12918013
          Length = 271

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +1

Query: 157 CLGPLEKGKILVWFEPTQLGVQNCKVSFKSTLAVNLFNIKGI---ATEPKPQARTK 315
           C+G  E+G    +    QL + N + S  +  AVNLF+ +G+   ++ P P  R K
Sbjct: 210 CIGLAEEGISSCYQLMQQLVIGNVQRSAAAAAAVNLFSDEGLSYDSSSPPPPKRRK 265


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,749,055
Number of Sequences: 37544
Number of extensions: 338799
Number of successful extensions: 621
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 613
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 621
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1898162308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -