SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20083
         (676 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_17538| Best HMM Match : Iso_dh (HMM E-Value=0)                     115   4e-26
SB_26442| Best HMM Match : Iso_dh (HMM E-Value=3.6e-37)               103   2e-22
SB_22958| Best HMM Match : RasGAP_C (HMM E-Value=0.23)                 31   1.1  
SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_26728| Best HMM Match : Disintegrin (HMM E-Value=1.9e-23)           29   2.6  
SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35)                   29   4.5  
SB_57195| Best HMM Match : UPF0126 (HMM E-Value=1.8)                   28   6.0  
SB_8123| Best HMM Match : Tfb2 (HMM E-Value=0.00019)                   28   6.0  

>SB_17538| Best HMM Match : Iso_dh (HMM E-Value=0)
          Length = 644

 Score =  115 bits (276), Expect = 4e-26
 Identities = 51/69 (73%), Positives = 60/69 (86%)
 Frame = +1

Query: 301 RLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCATITPDEQRVEEFKL 480
           +LI PY+ +D  YFDLGL HRDAT+D+VT+++A AI KH+VGIKCATITPDE RVEEFKL
Sbjct: 19  QLISPYLDLDIKYFDLGLEHRDATNDKVTVEAAEAIRKHHVGIKCATITPDEARVEEFKL 78

Query: 481 KKMWLSPNG 507
           KKMW SPNG
Sbjct: 79  KKMWKSPNG 87



 Score = 97.1 bits (231), Expect = 1e-20
 Identities = 41/59 (69%), Positives = 48/59 (81%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFR PI+C+++PR+VPGW KPIVIGRHA GDQY+A+DF V  PG  E
Sbjct: 85  PNGTIRNILGGTVFRAPIICKTVPRLVPGWEKPIVIGRHAFGDQYRARDFAVNGPGSFE 143


>SB_26442| Best HMM Match : Iso_dh (HMM E-Value=3.6e-37)
          Length = 296

 Score =  103 bits (246), Expect = 2e-22
 Identities = 45/59 (76%), Positives = 50/59 (84%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNILGGTVFRE I+C++IPR+V  WTKPI+IGRHAH DQYKA DFVVP PGKVE
Sbjct: 59  PNGTIRNILGGTVFREAIICKNIPRLVSPWTKPIIIGRHAHADQYKATDFVVPGPGKVE 117



 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 42/56 (75%), Positives = 50/56 (89%)
 Frame = +1

Query: 340 FDLGLPHRDATDDQVTIDSAHAILKHNVGIKCATITPDEQRVEEFKLKKMWLSPNG 507
           +DL + +RDAT+DQVTID+A AI + +VGIKCATITPDE+RVEEFKLKKMW SPNG
Sbjct: 6   YDLSIENRDATNDQVTIDAAAAIKQCHVGIKCATITPDEKRVEEFKLKKMWKSPNG 61


>SB_22958| Best HMM Match : RasGAP_C (HMM E-Value=0.23)
          Length = 1178

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = +2

Query: 83  ELVVDPRNHEQW*IHEQYRNMANTSTTKILKCVNQFASLTRNYGTAK 223
           EL++D +N E   I   YRN      T I K   + +S+TR   T K
Sbjct: 190 ELILDRKNMELEEIKAHYRNKVTEMETTIKKHERKISSMTRESSTLK 236


>SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1378

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 14/51 (27%), Positives = 24/51 (47%)
 Frame = +1

Query: 349 GLPHRDATDDQVTIDSAHAILKHNVGIKCATITPDEQRVEEFKLKKMWLSP 501
           G+ HRD   D + +     +   + G  CATITP++ +         W++P
Sbjct: 336 GVIHRDIKSDNILLGMDGQVKLTDFGF-CATITPEQNKRSTMVGTPYWMAP 385


>SB_26728| Best HMM Match : Disintegrin (HMM E-Value=1.9e-23)
          Length = 1531

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = +1

Query: 259 GDEMTRIMWAKIKE-RLIFPYVKVDCLYFDLGLPHRDATDDQVTIDS 396
           G+E+  ++W+   + RL   ++K DC+   LGL + D  D Q+T  S
Sbjct: 432 GNEVELLLWSGCDDQRLELWFMKQDCV-LPLGLRNGDIPDSQITASS 477


>SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35)
          Length = 2748

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 12/52 (23%), Positives = 26/52 (50%)
 Frame = +2

Query: 50   KIILLLALQARELVVDPRNHEQW*IHEQYRNMANTSTTKILKCVNQFASLTR 205
            + + + + QA   V+D   H    +H + R+ +N  +  +L C  + + LT+
Sbjct: 2225 RAVRIYSKQAETTVIDGSGHSNLALHMRVRHASNPHSKALLSCEAEISRLTQ 2276


>SB_57195| Best HMM Match : UPF0126 (HMM E-Value=1.8)
          Length = 1699

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 6/60 (10%)
 Frame = +1

Query: 418  NVGIKCATITPDEQ-RVEEFKLKKMWLSPNGRSVTFWAVQ-----YSANRYCVRVSRGLC 579
            N G K  +++     RV    + K WL P GR    W+ +        + YCV  S G C
Sbjct: 1356 NNGAKLTSVSKSNGFRVVSTNIDKRWLGPGGRLTATWSSRDLQSGVIKSEYCVGKSLGGC 1415


>SB_8123| Best HMM Match : Tfb2 (HMM E-Value=0.00019)
          Length = 448

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 15/30 (50%), Positives = 19/30 (63%)
 Frame = -1

Query: 592 FVQPGTTLGIL*HNIGSRNTVPPKMLRIFR 503
           F  P T L +  +NIGS NT+  K LRI+R
Sbjct: 38  FCHPATCLTVFRYNIGSLNTL--KQLRIWR 65


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,209,854
Number of Sequences: 59808
Number of extensions: 435354
Number of successful extensions: 1113
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1026
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1112
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1733301648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -