SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20081
         (635 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36)                  75   6e-14
SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38)                 72   5e-13
SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.)              64   7e-11
SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.)              61   6e-10
SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16)                   58   8e-09
SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   7e-08
SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0)                       52   4e-07
SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18)                 51   7e-07
SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24)                 48   5e-06
SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18)                   48   5e-06
SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0)                       48   5e-06
SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0)               47   1e-05
SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0)                       46   2e-05
SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013)                   46   3e-05
SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   3e-05
SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20)                  45   6e-05
SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0)                        44   1e-04
SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24)                 44   1e-04
SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0)                       43   2e-04
SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.)               43   2e-04
SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0)                        43   2e-04
SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25)                 42   3e-04
SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0)                42   6e-04
SB_13046| Best HMM Match : La (HMM E-Value=5e-23)                      42   6e-04
SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15)                     41   0.001
SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28)                 41   0.001
SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33)                 40   0.001
SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18)                 40   0.002
SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.)               40   0.002
SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.)               39   0.003
SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15)                 39   0.004
SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.005
SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.007
SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07)                  38   0.009
SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39)                 37   0.012
SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.016
SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11)                  37   0.016
SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.)                36   0.021
SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21)                 35   0.048
SB_35697| Best HMM Match : RRM_1 (HMM E-Value=1.3e-19)                 35   0.048
SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.048
SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.048
SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.)               35   0.064
SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.084
SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42)             34   0.11 
SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.11 
SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.11 
SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07)                 33   0.15 
SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.15 
SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28)                 33   0.19 
SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33)                  33   0.19 
SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.19 
SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23)                    33   0.19 
SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.26 
SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.26 
SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017)                   31   0.59 
SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35)                 31   0.78 
SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23)                31   0.78 
SB_11425| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07)                 31   1.0  
SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13)                 30   1.4  
SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14)                 30   1.8  
SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_43316| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.8  
SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_8368| Best HMM Match : VWA (HMM E-Value=0)                          29   2.4  
SB_40017| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.4  
SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.2  
SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0)                    29   4.2  
SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.5  
SB_41149| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_19883| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_7579| Best HMM Match : HEAT (HMM E-Value=0.0096)                    27   9.7  

>SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36)
          Length = 328

 Score = 74.5 bits (175), Expect = 6e-14
 Identities = 33/77 (42%), Positives = 52/77 (67%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSE-FGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTP 431
           FVGGL  E SD++IR +F + +  + E+E   + + N+R+GFCF++F+SE  V+ + +T 
Sbjct: 106 FVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQ 165

Query: 432 KRTIGGKEVDVKRATPK 482
              I G +V+VKRA PK
Sbjct: 166 FHNIEGNKVEVKRALPK 182



 Score = 69.3 bits (162), Expect = 2e-12
 Identities = 31/79 (39%), Positives = 52/79 (65%), Gaps = 1/79 (1%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFG-AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           R +K+FVGGL  ET+D+++R++FG AY  ++ I   T+ ++ R RGF F+ F + +++DK
Sbjct: 101 RVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDK 160

Query: 178 VMAAGEHTINNKKVDPKKA 234
           +     H I   KV+ K+A
Sbjct: 161 ICETQFHNIEGNKVEVKRA 179



 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 29/57 (50%), Positives = 40/57 (70%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           KLFVGGLS+ETT + L+++F  YGE+  +++K D  TGR RGFAF+ FK     D +
Sbjct: 30  KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAI 86



 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 19/64 (29%), Positives = 37/64 (57%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGGLS E + + ++ +FS++G ++ V++  D    + +GF F+ F+ +   + +   P 
Sbjct: 32  FVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAIDPKPA 91

Query: 435 RTIG 446
             IG
Sbjct: 92  APIG 95


>SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38)
          Length = 496

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 28/79 (35%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           K+F+GGL+W TT++ L+D+F  +G I + + +K D   GRSRGF F+ +++ +S+++V+ 
Sbjct: 51  KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRD---GRSRGFGFVTYESSDSVNEVLK 107

Query: 187 AGEHTINNKKVDPKKAKAR 243
             +H +++++++PK++  R
Sbjct: 108 KKDHVLDDREIEPKRSVPR 126



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 28/82 (34%), Positives = 52/82 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+   +++ ++++FS++GTI  V+    K   + +GF F+T+ES   VN++LK   
Sbjct: 53  FIGGLNWNTTEEGLKDYFSQWGTI--VDCVIMKRDGRSRGFGFVTYESSDSVNEVLKKKD 110

Query: 435 RTIGGKEVDVKRATPKPDGPGA 500
             +  +E++ KR+ P+ D  GA
Sbjct: 111 HVLDDREIEPKRSVPR-DESGA 131



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 31/104 (29%), Positives = 57/104 (54%), Gaps = 7/104 (6%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAY------GEIESINVKTD-PNTGRSRGFAFIVFKAPES 168
           K+FVGGL+  T +++++++F +       GE+  +++K D  N  R RGFAF+ F   E 
Sbjct: 140 KIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEI 199

Query: 169 IDKVMAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSE 300
           ++KV A   H I  K+ + KKA+ +      ++    S+  + +
Sbjct: 200 VEKVCAMKYHEIRMKQCEVKKAEPQSAMRKKDEQEYNSRSSRDK 243



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 29/99 (29%), Positives = 57/99 (57%), Gaps = 7/99 (7%)
 Frame = +3

Query: 207 QQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEF------GTILEVEMPFDKTKNQR 368
           + ES   E  S T + FVGGL+S   +++I+ +F+        G +++V++  D+   +R
Sbjct: 126 RDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKR 185

Query: 369 -KGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
            +GF F+TF+++++V  +       I  K+ +VK+A P+
Sbjct: 186 IRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 224


>SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 299

 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 5/83 (6%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF---KAPESI--D 174
           KLFVGGL+ ETT++ LR++F AYGE+  + V  D  T +SRGF ++ F   K   ++  D
Sbjct: 15  KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKD 74

Query: 175 KVMAAGEHTINNKKVDPKKAKAR 243
           KV   G H I+ K+V+ K+A  R
Sbjct: 75  KV-ENGAHRIDGKEVEVKRAIPR 96



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 29/82 (35%), Positives = 48/82 (58%), Gaps = 4/82 (4%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK--- 425
           FVGGL+ E +++ +R +F  +G + +V +  D    + +GF ++TF   +V  ++LK   
Sbjct: 17  FVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKV 76

Query: 426 -TPKRTIGGKEVDVKRATPKPD 488
                 I GKEV+VKRA P+ D
Sbjct: 77  ENGAHRIDGKEVEVKRAIPRDD 98



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEF--GTILEVEMPFDKT-KNQRKGFCFITFESEQVVNDLLK 425
           FVGGL  + + ++I+          + +V++   K  + + +GF F+   +E   ++L  
Sbjct: 111 FVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKHRGFAFVELNNEDQADELCC 170

Query: 426 TPKRTIGGKEVDVKRATPK 482
             K  + GK V+ K+ATP+
Sbjct: 171 VKKIHVKGKMVEAKKATPR 189



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 22/83 (26%), Positives = 45/83 (54%), Gaps = 4/83 (4%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGE--IESINV--KTDPNTGRSRGFAFIVFKAPESID 174
           +K+FVGGL  + T +++++   +  E  ++ +++  K +  T + RGFAF+     +  D
Sbjct: 108 KKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDET-KHRGFAFVELNNEDQAD 166

Query: 175 KVMAAGEHTINNKKVDPKKAKAR 243
           ++    +  +  K V+ KKA  R
Sbjct: 167 ELCCVKKIHVKGKMVEAKKATPR 189


>SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 435

 Score = 61.3 bits (142), Expect = 6e-10
 Identities = 29/67 (43%), Positives = 41/67 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L V GL + TT+ E++++F  +GEI+   VK DPNT RSRGF F+ FK  E    V++  
Sbjct: 117 LIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLST- 175

Query: 193 EHTINNK 213
            H I  +
Sbjct: 176 SHRIQGR 182



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 21/75 (28%), Positives = 40/75 (53%)
 Frame = +3

Query: 264 GLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTI 443
           GL    ++ E++ +F+ FG I   E+  D    + +GF F+ F+ ++   ++L T  R I
Sbjct: 121 GLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLSTSHR-I 179

Query: 444 GGKEVDVKRATPKPD 488
            G+  +V+   PK +
Sbjct: 180 QGRLCEVRLPRPKEE 194



 Score = 33.5 bits (73), Expect = 0.15
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGF 138
           +KLFVG L   TT+K L ++F  +GE+  + +   P   R  GF
Sbjct: 199 KKLFVGRLPESTTEKTLMEYFAQFGEVTDVYI---PKPFRHFGF 239



 Score = 31.5 bits (68), Expect = 0.59
 Identities = 18/60 (30%), Positives = 31/60 (51%)
 Frame = +3

Query: 219 RPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           RPKE  +   + FVG L    ++  +  +F++FG + +V +P        + F F+TF S
Sbjct: 190 RPKEELNVPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIP-----KPFRHFGFVTFAS 244


>SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16)
          Length = 842

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 30/89 (33%), Positives = 47/89 (52%)
 Frame = +1

Query: 55  LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 234
           LR HF  +GE++   V  DP T RSRGF F+ FK P+++D V+ +G   ++ KK+     
Sbjct: 124 LRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKMVTTTK 183

Query: 235 KARHGKILSEDSAVKSQMMKSETSSVNLE 321
           K   G + +  S    +   S+   V+ E
Sbjct: 184 KIFIGGLSTNTSEEDMKKYFSQFGKVSCE 212



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = +3

Query: 210 QESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCF-I 386
           QE   K+  +TT + F+GGLS+  S+++++ +FS+FG +   E   +  K++       +
Sbjct: 171 QELDGKKMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKV-SCEYETEDVKDELAAVLISV 229

Query: 387 TFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 491
                 + N    TP +T   K   V+R T    G
Sbjct: 230 HSNGTHITNQTPSTPNQT--AKVEKVRRPTVSSAG 262



 Score = 36.3 bits (80), Expect = 0.021
 Identities = 16/62 (25%), Positives = 35/62 (56%)
 Frame = +3

Query: 273 SEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGK 452
           ++ S + +R  F +FG + E  +  D    + +GF F+TF+  + V+ +L +  + + GK
Sbjct: 117 TQASAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGK 176

Query: 453 EV 458
           ++
Sbjct: 177 KM 178



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 9/27 (33%), Positives = 22/27 (81%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEI 87
           +K+F+GGLS  T++++++ +F  +G++
Sbjct: 183 KKIFIGGLSTNTSEEDMKKYFSQFGKV 209


>SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 314

 Score = 54.4 bits (125), Expect = 7e-08
 Identities = 24/75 (32%), Positives = 45/75 (60%), Gaps = 2/75 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTI--LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 428
           F+GGL  E S+++++   +       LE++M  D+  N+ KG+CF+ F +E +V+ L   
Sbjct: 107 FIGGLKDEHSEEDVKTALAPLSPFAPLEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLV 166

Query: 429 PKRTIGGKEVDVKRA 473
               + GK+V++K+A
Sbjct: 167 RHIQVKGKDVEMKKA 181



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 31/85 (36%), Positives = 53/85 (62%), Gaps = 7/85 (8%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHF-----GAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESI 171
           KLFVGGL+ +TT++ +R +F     G+  ++ S+++   P  G+SR F F+ F    + I
Sbjct: 9   KLFVGGLNEDTTEETVRAYFKSFCEGSEADVSSVSLAKTPE-GKSRKFCFVEFSNGSDII 67

Query: 172 DKVMAAGE-HTINNKKVDPKKAKAR 243
           D ++   E H+I+NK+V+ K+A  R
Sbjct: 68  DNIVFNFESHSIDNKQVEVKRAMPR 92



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 2/80 (2%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKT--DPNTGRSRGFAFIVFKAPESID 174
           R +KLF+GGL  E ++++++           + +K   D  T + +G+ F+ F     +D
Sbjct: 102 RTKKLFIGGLKDEHSEEDVKTALAPLSPFAPLEIKMVRDRETNKFKGYCFVNFPNEHIVD 161

Query: 175 KVMAAGEHTINNKKVDPKKA 234
           K+       +  K V+ KKA
Sbjct: 162 KLYLVRHIQVKGKDVEMKKA 181


>SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 420

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +FVGGL+  T ++ L+D+F  +GE+ES+ +      G SR + F++FK  +   K +   
Sbjct: 82  VFVGGLASGTDEEGLKDYFEQFGEVESVRIMR-TFLGYSRNYGFVLFK-DDGPSKEVLKK 139

Query: 193 EHTINNKKVDPKKAK 237
            H IN K VD  K++
Sbjct: 140 SHVINGKTVDVGKSR 154



 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 21/73 (28%), Positives = 41/73 (56%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R   LFV  LS +T + ++  +F  YG++  +++ TD  TG+S+G   +  + P +++K+
Sbjct: 317 RERTLFVDNLSEDTKELDVLRYFRPYGQVAKVHILTDRETGKSKGCGVVKLRHPGTVNKI 376

Query: 181 MAAGEHTINNKKV 219
           +    H I   +V
Sbjct: 377 LEEPVHVIGKSQV 389



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 22/84 (26%), Positives = 43/84 (51%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           PK+    +   FVGGL+S   ++ ++++F +FG +  V +         + + F+ F+ +
Sbjct: 72  PKDIEKNSRSVFVGGLASGTDEEGLKDYFEQFGEVESVRI-MRTFLGYSRNYGFVLFKDD 130

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRA 473
               ++LK     I GK VDV ++
Sbjct: 131 GPSKEVLK-KSHVINGKTVDVGKS 153



 Score = 35.9 bits (79), Expect = 0.028
 Identities = 24/71 (33%), Positives = 38/71 (53%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +KL V  L ++TT  ELR++F   GE+  I++    N+ +    A + F+  + I KV+ 
Sbjct: 236 KKLMVQDLDFDTTVDELREYFEKCGELTGIDLLI--NSEKRTCAAIVFFRNLKDIKKVVE 293

Query: 187 AGEHTINNKKV 219
              HTI   KV
Sbjct: 294 E-NHTIKGLKV 303



 Score = 32.7 bits (71), Expect = 0.26
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRG 135
           ++VGGL    T++ +R+HF  +G IE++    + + G   G
Sbjct: 159 IYVGGLPSHFTEQTVREHFKKFGVIEAVKFIENTSVGAKTG 199



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVE 338
           +VGGL S  ++  +R  F +FG I  V+
Sbjct: 160 YVGGLPSHFTEQTVREHFKKFGVIEAVK 187


>SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18)
          Length = 291

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 4/81 (4%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVGG+  E  DD +R FF++FG I E  +  D+   + KG+ F+T  +        K  +
Sbjct: 13  FVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAELACKNKR 72

Query: 435 RTIGGKEVDVK----RATPKP 485
             I G++ +V      A PKP
Sbjct: 73  PMIEGRQANVNLAYLGAKPKP 93



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           KLFVGG+ +E+ D  LR  F  +GEI    V  D  T +S+G+ F+     ++ +
Sbjct: 11  KLFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAE 65


>SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24)
          Length = 343

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 30/103 (29%), Positives = 56/103 (54%), Gaps = 4/103 (3%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGE-IESIN-VKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +FVG L   T +  + ++F   GE +E +  ++T   +G+S+GFAF+  +  E+++ V+ 
Sbjct: 44  IFVGSLHPSTVESTIFEYFSTLGEQVEHVKCIRT--LSGKSKGFAFVRLRKKEAVESVLG 101

Query: 187 AGEHTINNKKVDPKKAKARHGKILSE--DSAVKSQMMKSETSS 309
             +H I+N  V  +K       IL     S  +SQ+++  +SS
Sbjct: 102 RDDHVIDNSDVSMEKQDTYRKVILKNIPSSIGESQILEHFSSS 144



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/64 (31%), Positives = 32/64 (50%)
 Frame = +3

Query: 267 LSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIG 446
           + S I + +I   FS  G I  V +P +    +RKG C +TF S     +++K  K  I 
Sbjct: 128 IPSSIGESQILEHFSSSGEIASVYIPENLKTKERKGHCIVTFASVTEAFEVVKKRKHHIH 187

Query: 447 GKEV 458
           G ++
Sbjct: 188 GYDI 191



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 17/72 (23%), Positives = 29/72 (40%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG L     +  I  +FS  G  +E          + KGF F+    ++ V  +L    
Sbjct: 45  FVGSLHPSTVESTIFEYFSTLGEQVEHVKCIRTLSGKSKGFAFVRLRKKEAVESVLGRDD 104

Query: 435 RTIGGKEVDVKR 470
             I   +V +++
Sbjct: 105 HVIDNSDVSMEK 116



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 13/68 (19%), Positives = 32/68 (47%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + K+ +  +     + ++ +HF + GEI S+ +  +  T   +G   + F +     +V+
Sbjct: 120 YRKVILKNIPSSIGESQILEHFSSSGEIASVYIPENLKTKERKGHCIVTFASVTEAFEVV 179

Query: 184 AAGEHTIN 207
              +H I+
Sbjct: 180 KKRKHHIH 187


>SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18)
          Length = 268

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 23/55 (41%), Positives = 35/55 (63%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDL 419
           FV G + E ++ E+R FF E+G + E ++  DK     KG+ FITFES++V + L
Sbjct: 11  FVKGFNRETTESELRAFFEEYGVVKESKIVRDK-HGVSKGYAFITFESQEVADGL 64



 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 22/56 (39%), Positives = 35/56 (62%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           +++FV G + ETT+ ELR  F  YG ++   +  D + G S+G+AFI F++ E  D
Sbjct: 8   KRIFVKGFNRETTESELRAFFEEYGVVKESKIVRDKH-GVSKGYAFITFESQEVAD 62


>SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 718

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 27/102 (26%), Positives = 56/102 (54%), Gaps = 1/102 (0%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++V     +  D+++++     G+I S+ V TDP  G+S+GF F+ F+ PE  ++ +   
Sbjct: 111 VYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPE-GKSKGFGFVSFETPEEAEEAV--- 166

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSA-VKSQMMKSETSSVN 315
            + +N K++  ++  A   K  +E +A VK+++ K     +N
Sbjct: 167 -NVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERIN 207



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 21/57 (36%), Positives = 30/57 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L++  L     D+ LR+ F  YG I S  V  D + G S+GF F+ F +PE   K +
Sbjct: 214 LYIKNLDDPIDDERLREEFSPYGTISSAKVMKD-DKGNSKGFGFVCFSSPEEATKAV 269



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP---ESIDKVM 183
           L+VG L+ + T+  L + F   G + SI V  D  T RS G+A++ F+ P    +++ + 
Sbjct: 15  LYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHDAALEAIA 74

Query: 184 AAGEHTINNKKV 219
                 +N+KKV
Sbjct: 75  RVDGMLLNDKKV 86


>SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0)
          Length = 298

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 23/76 (30%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTP 431
           +VGGL+ E+ +  +   F  FG I +V++P D T ++ +GF F+ FE +E     +    
Sbjct: 8   YVGGLAEEVDEKVLHAAFIPFGDITDVQIPMDYTTSKHRGFGFVEFEFAEDTAAAIDNMN 67

Query: 432 KRTIGGKEVDVKRATP 479
           +  + G+ + V  A P
Sbjct: 68  ESELFGRTIRVNLAKP 83



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 29/92 (31%), Positives = 45/92 (48%), Gaps = 7/92 (7%)
 Frame = +1

Query: 16  FVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE----SIDKVM 183
           +VGGL+ E  +K L   F  +G+I  + +  D  T + RGF F+ F+  E    +ID + 
Sbjct: 8   YVGGLAEEVDEKVLHAAFIPFGDITDVQIPMDYTTSKHRGFGFVEFEFAEDTAAAIDNMN 67

Query: 184 AAG--EHTINNKKVDPKKAKARHGK-ILSEDS 270
            +     TI      P K K  + + + SEDS
Sbjct: 68  ESELFGRTIRVNLAKPMKIKEGYSRAVWSEDS 99


>SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 382

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 3/68 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           LF+G L  E  +K L D F A+G I ++  +  D +TG S+GFAFI F + ++ D  + A
Sbjct: 102 LFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEA 161

Query: 190 --GEHTIN 207
             G++  N
Sbjct: 162 MNGQYLCN 169



 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VGGL  ++S+  I   F + G ++ V MP D+     +G+ F+ F  E+  +  +K   
Sbjct: 16  YVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMN 75

Query: 435 R-TIGGKEVDVKRAT 476
              + GK + V +A+
Sbjct: 76  MIKVYGKPIRVNKAS 90



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV-EMPFDKTKNQRKGFCFITFES 398
           F+G L +E+ +  + + FS FG IL+  ++  D      KGF FI F S
Sbjct: 103 FIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFAS 151


>SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013)
          Length = 665

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 21/45 (46%), Positives = 27/45 (60%)
 Frame = +1

Query: 109 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 243
           D  T R RGF F+ F++  S DK      H INNKKV+ KKA+ +
Sbjct: 5   DKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 20/46 (43%), Positives = 27/46 (58%)
 Frame = +3

Query: 345 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           FDK   + +GF F+TFESE   +    T    I  K+V+VK+A PK
Sbjct: 4   FDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49


>SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 291

 Score = 45.6 bits (103), Expect = 3e-05
 Identities = 18/57 (31%), Positives = 36/57 (63%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 171
           R  KL++G L++ + + E+   F  +G +E +++  D  +GRSRGF F++ ++ + I
Sbjct: 7   RGRKLYIGNLNFNSDEGEIEQAFEEFG-VEKVDILRDKESGRSRGFGFVLLQSADQI 62



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           ++G L+    + EI   F EFG + +V++  DK   + +GF F+  +S +Q+   + K  
Sbjct: 12  YIGNLNFNSDEGEIEQAFEEFG-VEKVDILRDKESGRSRGFGFVLLQSADQIAPAIEKMN 70

Query: 432 KRTIGGKEVDVKRATPKPDGPG 497
           + ++GG+ + V  A  K +  G
Sbjct: 71  QSSVGGRNITVALALDKTENRG 92


>SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20)
          Length = 1313

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +3

Query: 255  FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
            +V  L+  ++ D ++  FS +G +  V++P D+T N  +GF ++ + + E+    L    
Sbjct: 1160 YVAHLTRNVNKDHVQEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKALKHMD 1219

Query: 432  KRTIGGKEVDVKRATP 479
               I G+E+ V+   P
Sbjct: 1220 GGQIDGQEIAVQSVLP 1235



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 17/58 (29%), Positives = 33/58 (56%)
 Frame = +1

Query: 10   KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
            KL+V  L+       +++ F  YG ++++++ TD     SRGFA++ +  PE  +K +
Sbjct: 1158 KLYVAHLTRNVNKDHVQEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKAL 1215


>SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 593

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG ++ E+ ++ IR  F  FG I ++++ +D    + KGF F+ ++  +     L+   
Sbjct: 105 YVGSINFELREEHIRTAFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLPEAAQLALEQMN 164

Query: 435 RT-IGGKEVDVKRATPKP 485
              +GG+ + V R +  P
Sbjct: 165 GVLLGGRNIKVGRPSNVP 182



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/78 (24%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           ++  +  ++ +D+I++ F  FG ++   +  +    + KG+ FI +E++Q  ND + +  
Sbjct: 202 YIASVHPDLLEDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIASMN 261

Query: 435 R-TIGGKEVDVKRATPKP 485
              +GG+ + V RA   P
Sbjct: 262 LFDLGGQFLRVGRAITPP 279



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 16/53 (30%), Positives = 33/53 (62%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++VG +++E  ++ +R  F  +G I  I++  DP   + +GFAF+ +  PE+
Sbjct: 103 RVYVGSINFELREEHIRTAFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLPEA 155



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 11/63 (17%), Positives = 38/63 (60%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           ++ ++++  +  +  + +++  F A+G++   ++  +P TG+ +G+ FI ++  +S +  
Sbjct: 197 KYARIYIASVHPDLLEDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDA 256

Query: 181 MAA 189
           +A+
Sbjct: 257 IAS 259


>SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24)
          Length = 407

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 17/73 (23%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   HEK-LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           H++ +F+G L ++  ++ LR+ F   G +ES+ +  D  TG  +GF +++F++ +++   
Sbjct: 54  HQRSVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFA 113

Query: 181 MAAGEHTINNKKV 219
           +         +K+
Sbjct: 114 LKMNNAEFKGRKI 126



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 22/77 (28%), Positives = 38/77 (49%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+G L  +I ++ +R  F+  G +  V +  D+     KGF ++ FES+  V   LK   
Sbjct: 59  FIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNN 118

Query: 435 RTIGGKEVDVKRATPKP 485
               G+++ V  +  KP
Sbjct: 119 AEFKGRKIRVFPSKDKP 135


>SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 514

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 17/58 (29%), Positives = 34/58 (58%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +L+VG L +  T+  ++  F  +G ++S+ +  D  T RS+G+ F+ F+  E+  + M
Sbjct: 243 RLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAM 300



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           +VG L   I++  ++  F  FGT+  V++ +D   N+ KG+ F+ F E+E     + +  
Sbjct: 245 YVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMN 304

Query: 432 KRTIGGKEVDVKRATPKPD 488
              + G+ + +   T + D
Sbjct: 305 GFELAGRPLKIGPVTERGD 323


>SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 215

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++VG L +  T+ +L   F  YG++  + +  D  T  SRG AFI+F   +S    +AA
Sbjct: 12  VYVGNLPYSLTNSDLHKVFERYGKVVKVTILRDKETRESRGVAFILFIDRQSAQNAVAA 70


>SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 21/57 (36%), Positives = 31/57 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           L V  L++ TT ++L+  F  YG++  I +  D NT  SRGFAF+ F      +  M
Sbjct: 18  LKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYEKRDAEDAM 74


>SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 364

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 20/79 (25%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMA 186
           K ++G L ++  + +L+D F  Y ++  + V +D  T R RGFAF+ F + +++ D +  
Sbjct: 231 KCYIGNLDFKVNEADLQDRFSRY-DVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINE 289

Query: 187 AGEHTINNKKVDPKKAKAR 243
                 + + +   +A++R
Sbjct: 290 LDGQEFDGRSMKVNQARSR 308



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 17/82 (20%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTP 431
           ++G L  ++++ ++++ FS +  +++V++  D+   + +GF F+TF S++ + D + +  
Sbjct: 233 YIGNLDFKVNEADLQDRFSRYD-VVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELD 291

Query: 432 KRTIGGKEVDVKRATPKPDGPG 497
            +   G+ + V +A  +    G
Sbjct: 292 GQEFDGRSMKVNQARSREQRGG 313



 Score = 35.1 bits (77), Expect = 0.048
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +1

Query: 91  SINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           S+ V TD  TGR RGF F+ F + + +DK +
Sbjct: 37  SVKVITDRETGRPRGFGFVTFGSEDEMDKAI 67



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +3

Query: 324 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGPG 497
           +L V++  D+   + +GF F+TF SE  ++  + K     + G+ + V +A P+ +  G
Sbjct: 35  LLSVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPRGERGG 93


>SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0)
          Length = 1026

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 19/59 (32%), Positives = 36/59 (61%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +F+  LS+++T K + + F  +G+I    V  D  T  S+G AF+ +++ ES+ + +AA
Sbjct: 418 VFIRNLSFDSTQKNITNLFKQFGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAA 476



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 19/72 (26%), Positives = 29/72 (40%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+  LS + +   I N F +FG I   ++  D      KG  F+ + S + V   L    
Sbjct: 419 FIRNLSFDSTQKNITNLFKQFGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAATD 478

Query: 435 RTIGGKEVDVKR 470
               G  +D  R
Sbjct: 479 EDSEGLFLDGNR 490


>SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25)
          Length = 159

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 18/58 (31%), Positives = 33/58 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + ++G LS+   ++ L + F    ++  + V TD  TGR RGF F+ F + E ++K +
Sbjct: 6   RCYIGNLSYSVDEQALEEKFHGC-DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAI 62



 Score = 30.3 bits (65), Expect = 1.4
 Identities = 17/77 (22%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTP 431
           ++G LS  + +  +   F     +++V++  D+   + +GF F+TF S E++   + +  
Sbjct: 8   YIGNLSYSVDEQALEEKFHGCD-VVDVKVITDRETGRPRGFGFVTFGSKEEMEKAIDEFD 66

Query: 432 KRTIGGKEVDVKRATPK 482
            +   G+ + V +A P+
Sbjct: 67  GQDFDGRPMKVNQAQPR 83


>SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 550

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 26/87 (29%), Positives = 45/87 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+VGGL  + T+++LRDHF  +GE+ SI++    N       AF+ F +  + +   AA 
Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGELRSISMVPRQNC------AFVCFTSRAAAE---AAA 356

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSA 273
           + + N   +  ++ K   GK   +  A
Sbjct: 357 DRSFNKLILKGRRLKIMWGKSQGQQPA 383



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 9/29 (31%), Positives = 20/29 (68%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           +VGGL  ++++ ++R+ F +FG +  + M
Sbjct: 307 YVGGLEGKVTEQDLRDHFYQFGELRSISM 335


>SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0)
          Length = 672

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 18/57 (31%), Positives = 35/57 (61%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           F G L SE++D+ +   F+++ + L+ ++  DK  N+ KG+ F++F+     ND +K
Sbjct: 220 FCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSFKDP---NDFIK 273



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/58 (31%), Positives = 27/58 (46%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           ++F G L  E TD+ L   F  Y       +  D  + +S+G+ F+ FK P    K M
Sbjct: 218 RIFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSFKDPNDFIKAM 275


>SB_13046| Best HMM Match : La (HMM E-Value=5e-23)
          Length = 442

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 19/39 (48%), Positives = 25/39 (64%)
 Frame = +3

Query: 288 DEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           D ++  FSEFG +L V +P  K   + KGF FI FES+Q
Sbjct: 102 DWLKKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQ 140



 Score = 35.9 bits (79), Expect = 0.028
 Identities = 28/116 (24%), Positives = 55/116 (47%)
 Frame = +1

Query: 55  LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 234
           L+  F  +G++  +++    + G  +GFAFI F++ +  + V+      + N++   KK 
Sbjct: 104 LKKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQQAEHVV-----QMFNRESKTKKE 158

Query: 235 KARHGKILSEDSAVKSQMMKSETSSVNLELS*KWRCPLTKQRTKERASVSSHLNLS 402
           + R   I  +    K +   SE+   + +LS   +    ++RT    SV S+ N S
Sbjct: 159 EKREPSIDDKTKIKKRRRSHSESDLESSKLSLS-QSERKRRRTTSETSVDSNENAS 213


>SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15)
          Length = 145

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +1

Query: 55  LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--DPK 228
           L   FG YG IE +++     TG+S+GF ++ ++  ES  + + AG H I+ K V  +PK
Sbjct: 79  LESVFGPYGAIEDLSI-IRTQTGKSKGFGYVTYENAESAQRAL-AGTHIIDGKWVIAEPK 136


>SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28)
          Length = 419

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 25/75 (33%), Positives = 38/75 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L++ GL   TTD +L      YG I S     D +T   +G+ F+ F++P S  K +AA 
Sbjct: 102 LYIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDFESPISAQKAVAA- 160

Query: 193 EHTINNKKVDPKKAK 237
              + NK +  + AK
Sbjct: 161 ---LVNKGIQAQMAK 172



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           ++ GL +  +DD++     ++GTI+  +   DK  N  KG+ F+ FES
Sbjct: 103 YIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDFES 150


>SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33)
          Length = 392

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 14/50 (28%), Positives = 30/50 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           FVG +  E S+++++  FSE G ++   + FD+   + KG+ F  ++ ++
Sbjct: 28  FVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQE 77



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 15/52 (28%), Positives = 31/52 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +FVG + +E ++++L++ F   G + S  +  D  TG+ +G+ F  +K  E+
Sbjct: 27  VFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQET 78


>SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18)
          Length = 209

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 30/94 (31%), Positives = 44/94 (46%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV  L+  TTD++L   F  +G I S  V  D  TG S  +AFI F+  E  ++     
Sbjct: 122 LFVCKLNPVTTDEDLEIIFSRFGTILSCEVIRDQKTGESLQYAFIEFEKDEDCERAY--- 178

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMK 294
              ++N  +D ++    H       S +K QM K
Sbjct: 179 -FKMDNVLIDDRRI---HVDFSQSVSKIKLQMRK 208



 Score = 35.9 bits (79), Expect = 0.028
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           FV  L+   +D+++   FS FGTIL  E+  D+   +   + FI FE ++
Sbjct: 123 FVCKLNPVTTDEDLEIIFSRFGTILSCEVIRDQKTGESLQYAFIEFEKDE 172


>SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1291

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 15/45 (33%), Positives = 29/45 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAF 144
           K+F+GGL     + ++++   ++GE+ + N+  D  TG S+G+AF
Sbjct: 674 KIFIGGLPNYLNEDQVKELLSSFGELRAFNLVKDSATGLSKGYAF 718



 Score = 35.5 bits (78), Expect = 0.036
 Identities = 17/75 (22%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TP 431
           F+GGL + +++D+++   S FG +    +  D      KG+ F  +    + +  ++   
Sbjct: 676 FIGGLPNYLNEDQVKELLSSFGELRAFNLVKDSATGLSKGYAFCEYVDLGITDVAIQGLN 735

Query: 432 KRTIGGKEVDVKRAT 476
              +G K++ V+RA+
Sbjct: 736 GMQLGDKKLIVQRAS 750


>SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 375

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 15/38 (39%), Positives = 24/38 (63%)
 Frame = +1

Query: 130 RGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 243
           +GF F+ F+ P +I+ V+A   H ++ K +DPK A  R
Sbjct: 142 KGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPR 179



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +3

Query: 345 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 497
           F++     KGF F+TF     +  +L      + GK +D K A P+  GPG
Sbjct: 134 FERRARMLKGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPR--GPG 182



 Score = 36.7 bits (81), Expect = 0.016
 Identities = 12/27 (44%), Positives = 23/27 (85%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIE 90
           K+F+GGL++ TT+++L+++F  YG +E
Sbjct: 203 KVFIGGLAFGTTEEDLKEYFSTYGMVE 229



 Score = 28.7 bits (61), Expect = 4.2
 Identities = 9/35 (25%), Positives = 23/35 (65%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTI 326
           P+ G +   + F+GGL+   ++++++ +FS +G +
Sbjct: 194 PQRGSANDGKVFIGGLAFGTTEEDLKEYFSTYGMV 228


>SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 721

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 3/73 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI---VFKAPESIDKVM 183
           LFV  +  E  + ++ + F  YGEI++++V  D  TG  +G+A +    FK  +S  + +
Sbjct: 295 LFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEAL 354

Query: 184 AAGEHTINNKKVD 222
              E    N  VD
Sbjct: 355 NGAEMLGQNISVD 367



 Score = 35.9 bits (79), Expect = 0.028
 Identities = 18/62 (29%), Positives = 30/62 (48%)
 Frame = +3

Query: 213 ESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           E  P EG    W  FV  +  E  +D+I   FS++G I  + +  D+     KG+  + +
Sbjct: 286 EWHPVEG----WILFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEY 341

Query: 393 ES 398
           E+
Sbjct: 342 ET 343


>SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 871

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           LFVG L +E T+ +  D    YG IE + +     TG S+G+ F+ +   E+
Sbjct: 115 LFVGNLPFEFTETQFGDLMSPYGNIERLFLVRSEVTGDSKGYGFVEYATREN 166



 Score = 34.3 bits (75), Expect = 0.084
 Identities = 17/65 (26%), Positives = 31/65 (47%)
 Frame = +1

Query: 55  LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 234
           +++ F   G +    V  +P  G SRGFAF+ +   E  +K    G+   N ++V+    
Sbjct: 222 IKELFSQTGNVTFAQVAINPANGGSRGFAFVDYATAEEAEK----GQRAHNGRQVEGSNI 277

Query: 235 KARHG 249
           +  +G
Sbjct: 278 RVAYG 282



 Score = 32.3 bits (70), Expect = 0.34
 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 4/70 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE----QVVNDLL 422
           FVG L  E ++ +  +  S +G I  + +   +     KG+ F+ + +     Q    LL
Sbjct: 116 FVGNLPFEFTETQFGDLMSPYGNIERLFLVRSEVTGDSKGYGFVEYATRENAMQAKQQLL 175

Query: 423 KTPKRTIGGK 452
            T  + IGG+
Sbjct: 176 NTASKYIGGR 185


>SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15)
          Length = 171

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 14/51 (27%), Positives = 29/51 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQV 407
           ++G +     ++EI+ FF +FGT+  + +   K   + KG+ F+ F  ++V
Sbjct: 101 YLGHIPHGFFENEIKKFFEQFGTVNRIRLSRSKKSARSKGYAFVEFACDEV 151



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 15/62 (24%), Positives = 32/62 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +++G +     + E++  F  +G +  I +     + RS+G+AF+ F A + + K+ A  
Sbjct: 100 IYLGHIPHGFFENEIKKFFEQFGTVNRIRLSRSKKSARSKGYAFVEF-ACDEVAKIAADT 158

Query: 193 EH 198
            H
Sbjct: 159 MH 160


>SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 381

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 22/77 (28%), Positives = 38/77 (49%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++F+G +  +  + EL       GEI    ++ DP TG ++GFAF  F    S  + +  
Sbjct: 154 EVFIGKIPRDCLEDELIPLLEKCGEIREFRLQMDPATGLNKGFAFCTFTEQTSAYQAIT- 212

Query: 190 GEHTINNKKVDPKKAKA 240
              T+N+K + P +  A
Sbjct: 213 ---TLNDKDIRPGRRLA 226



 Score = 33.5 bits (73), Expect = 0.15
 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 6/65 (9%)
 Frame = +3

Query: 225 KEG*STTW------EDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFI 386
           + G  TTW      E F+G +  +  +DE+     + G I E  +  D      KGF F 
Sbjct: 140 ERGFPTTWTEESGTEVFIGKIPRDCLEDELIPLLEKCGEIREFRLQMDPATGLNKGFAFC 199

Query: 387 TFESE 401
           TF  +
Sbjct: 200 TFTEQ 204


>SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 628

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +1

Query: 22  GGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 171
           GG   +  ++   +H  A G +E++ + TD NTG+ R F F+ F +P S+
Sbjct: 463 GGDDDDDYERGAINHSNA-GPLENVRIPTDKNTGQQRSFGFVEFSSPVSV 511


>SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07)
          Length = 252

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +1

Query: 88  ESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           E++N+ TD  TGR RGF F+ F + E ++K +
Sbjct: 123 EAVNIITDRETGRPRGFGFVTFGSKEEMEKAI 154


>SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39)
          Length = 507

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMA 186
           +++VG L  +  +K+L D F  YG I  +++K     G    FAF+ F+ P ++ D V  
Sbjct: 262 RVYVGNLPQDVREKDLHDIFYKYGHIADVDLKN--RRGAGPPFAFVEFEDPRDAEDAVKG 319

Query: 187 AGEHTINNKKV 219
              H  +  ++
Sbjct: 320 RDGHEFDGYRI 330


>SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 828

 Score = 36.7 bits (81), Expect = 0.016
 Identities = 14/58 (24%), Positives = 33/58 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 428
           +V  +  + + + I   F + G + +V++ +D  + Q KGFCF+T  +++   + ++T
Sbjct: 278 YVYNIGYDANQEGITALFGQCGIVNKVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQT 335



 Score = 31.5 bits (68), Expect = 0.59
 Identities = 14/47 (29%), Positives = 25/47 (53%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           L+V  +  +  + E R  F AYG I +  +  D +TG  +G  F+++
Sbjct: 135 LYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLY 181



 Score = 28.7 bits (61), Expect = 4.2
 Identities = 18/68 (26%), Positives = 28/68 (41%), Gaps = 1/68 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AA 189
           L V  +  + TD+  R  F A   + +  +     +G S GF F+ +   E   K +   
Sbjct: 49  LIVNYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKL 108

Query: 190 GEHTINNK 213
              TI NK
Sbjct: 109 NGFTIGNK 116


>SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11)
          Length = 248

 Score = 36.7 bits (81), Expect = 0.016
 Identities = 16/53 (30%), Positives = 30/53 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           + ++G LS+   ++ L + F     ++ + V TD  TGR RGF F+  +A ++
Sbjct: 83  RCYIGNLSYSVDEQALEEKFHDCNVVD-VRVITDRETGRPRGFGFVTLEAKKT 134



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 11/50 (22%), Positives = 28/50 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           ++G LS  + +  +   F +   +++V +  D+   + +GF F+T E+++
Sbjct: 85  YIGNLSYSVDEQALEEKFHDCN-VVDVRVITDRETGRPRGFGFVTLEAKK 133


>SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 783

 Score = 36.3 bits (80), Expect = 0.021
 Identities = 21/66 (31%), Positives = 34/66 (51%)
 Frame = +3

Query: 195 THHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKG 374
           T  QQ+   P+E    T   FVG L + IS  ++R  F +FG +L+V++     + Q   
Sbjct: 220 TPPQQEYIPPEEDPKATRTLFVGNLETGISCQDLRLSFEKFGVVLDVDIK-RPARGQGNT 278

Query: 375 FCFITF 392
           + F+ F
Sbjct: 279 YAFVKF 284


>SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21)
          Length = 304

 Score = 35.1 bits (77), Expect = 0.048
 Identities = 19/45 (42%), Positives = 26/45 (57%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           V  LS ET + +L++ F   G I  I +  D  T +S+GFAFI F
Sbjct: 185 VTNLSEETRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINF 229


>SB_35697| Best HMM Match : RRM_1 (HMM E-Value=1.3e-19)
          Length = 168

 Score = 35.1 bits (77), Expect = 0.048
 Identities = 18/60 (30%), Positives = 30/60 (50%)
 Frame = +3

Query: 249 EDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 428
           E FVG +  ++ +DE+   F   G I EV +  D    Q +G+ F+ + S+      +KT
Sbjct: 75  EVFVGKIPRDLYEDELVPVFETAGPIYEVRLMMD-FNGQNRGYAFVVYTSKDDAKRCVKT 133



 Score = 33.5 bits (73), Expect = 0.15
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 1/104 (0%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FVG +  +  + EL   F   G I  + +  D N G++RG+AF+V+ + +   + +  
Sbjct: 75  EVFVGKIPRDLYEDELVPVFETAGPIYEVRLMMDFN-GQNRGYAFVVYTSKDDAKRCV-- 131

Query: 190 GEHTINNKKVDPKKAKARHGKILSEDSAV-KSQMMKSETSSVNL 318
              T+NN ++       R GK +   S+V KS ++ +  + V+L
Sbjct: 132 --KTLNNYEI-------RKGKCIGVCSSVDKSLLVPTGMNGVDL 166


>SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 610

 Score = 35.1 bits (77), Expect = 0.048
 Identities = 16/57 (28%), Positives = 27/57 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK 425
           F+G +  +  +DE+   F E G I +  +  D      KGF F TF ++    + +K
Sbjct: 155 FIGKVPRDCFEDELIPVFEECGHIYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAVK 211



 Score = 33.5 bits (73), Expect = 0.15
 Identities = 19/74 (25%), Positives = 35/74 (47%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++F+G +  +  + EL   F   G I    +  DP +G ++GFAF  F   +     +  
Sbjct: 153 QVFIGKVPRDCFEDELIPVFEECGHIYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAV-- 210

Query: 190 GEHTINNKKVDPKK 231
               ++NK++ P K
Sbjct: 211 --KKLDNKEIRPGK 222


>SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 552

 Score = 35.1 bits (77), Expect = 0.048
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 3/59 (5%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPF---DKTKNQRKGFCFITFESEQVVNDLL 422
           FVGGL  +I +DEI   F  FG+ L V+ P     K+    KG+ F+ +  E  V  L+
Sbjct: 347 FVGGLPPDIDEDEIHASFCRFGS-LTVDWPHKAESKSYFPPKGYAFLLYLEEISVQKLI 404


>SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1309

 Score = 34.7 bits (76), Expect = 0.064
 Identities = 19/61 (31%), Positives = 33/61 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG L  ++ D E++  FS++G+ILE ++  D      KG+ FI    E+     L + +
Sbjct: 618 YVGNLPPDVKDYELQQMFSQYGSILETKVFAD------KGYAFINARGEKRRQRCLTSSR 671

Query: 435 R 437
           R
Sbjct: 672 R 672



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +3

Query: 330 EVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRATPK 482
           EV +  D  KN+ KGF F++F   E     + +    TIGGK+V    A  K
Sbjct: 541 EVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARK 592



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%)
 Frame = +1

Query: 94  INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKV 219
           + V  DP   +S+GF F+ F   E   K +A  +  TI  K+V
Sbjct: 542 VRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQV 584



 Score = 27.5 bits (58), Expect = 9.7
 Identities = 18/66 (27%), Positives = 29/66 (43%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           ++VG L  +  D EL+  F  YG I    V  D      +G+AFI  +  +   + + + 
Sbjct: 617 VYVGNLPPDVKDYELQQMFSQYGSILETKVFAD------KGYAFINARGEKRRQRCLTSS 670

Query: 193 EHTINN 210
               NN
Sbjct: 671 RRHGNN 676


>SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 732

 Score = 34.3 bits (75), Expect = 0.084
 Identities = 21/81 (25%), Positives = 36/81 (44%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+G LS +  ++ +  FF E G  L         + + +GF +  F S++  N  L+   
Sbjct: 183 FLGNLSFDADEETLAAFFEEKG--LSATCRVITQEGRSRGFGYADFTSKEDYNKALELNG 240

Query: 435 RTIGGKEVDVKRATPKPDGPG 497
               G+E+ +  A  KP   G
Sbjct: 241 EDCCGREIRINPANSKPSRGG 261



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 2/81 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA- 189
           +F+G LS++  ++ L   F   G   +  V T    GRSRGF +  F + E  +K +   
Sbjct: 182 VFLGNLSFDADEETLAAFFEEKGLSATCRVITQE--GRSRGFGYADFTSKEDYNKALELN 239

Query: 190 GEHTINNK-KVDPKKAKARHG 249
           GE     + +++P  +K   G
Sbjct: 240 GEDCCGREIRINPANSKPSRG 260



 Score = 31.1 bits (67), Expect = 0.78
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           +  L V  LS++TT   L     A+    +  V  D  +G SRGF F+ +   E+  KV+
Sbjct: 288 NSSLIVRNLSYDTTTDSLG---AAFEGCSNAKVIFDRESGESRGFGFVDYDDVETAKKVL 344

Query: 184 A 186
           +
Sbjct: 345 S 345



 Score = 29.1 bits (62), Expect = 3.2
 Identities = 12/52 (23%), Positives = 28/52 (53%), Gaps = 1/52 (1%)
 Frame = +3

Query: 345 FDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGPG 497
           FD+   + +GF F+ ++  +    +L +     + G++V +  A+P+ +G G
Sbjct: 319 FDRESGESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFASPRTEGGG 370


>SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42)
          Length = 1531

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           LFVG +   TT  +L++ F  YGE+  +++K  P    +  +AF+ F
Sbjct: 251 LFVGNIEKTTTYGDLKEAFERYGEVIDVDIKKQPG---NNPYAFVQF 294



 Score = 28.3 bits (60), Expect = 5.5
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINV--KTDPNTGRSRGFAFI 147
           L+VG L     ++++  HF  YG +ES+ +  K     GR+    F+
Sbjct: 8   LWVGNLPENIREEDIVKHFTRYGRVESVKILPKRSAEGGRASFVDFV 54



 Score = 27.9 bits (59), Expect = 7.3
 Identities = 9/35 (25%), Positives = 21/35 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPN 117
           ++VGG++   +++++  HFG YG +  + +    N
Sbjct: 330 IWVGGVTNSLSEQQVERHFGRYGRVTKVVINRVTN 364


>SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 621

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 17/68 (25%), Positives = 34/68 (50%), Gaps = 2/68 (2%)
 Frame = +1

Query: 25  GLSWETTDKELRDHFGAY--GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 198
           GL +E++ ++L   F       I+ +  K+  N G++ G AF+VFK+     K +     
Sbjct: 339 GLPFESSKRDLYKFFNGLKIASIDLLKHKSGKNQGKNTGVAFVVFKSNNDASKALKMDRS 398

Query: 199 TINNKKVD 222
            I ++ ++
Sbjct: 399 YIGHRYIE 406


>SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 14/42 (33%), Positives = 25/42 (59%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRG 135
           K+FVG + ++   +EL+D FG +G++    +  D    RS+G
Sbjct: 80  KVFVGNIGFKVRARELKDFFGYFGDVVYAQIIMDRVKKRSKG 121



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 12/40 (30%), Positives = 24/40 (60%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKG 374
           FVG +  ++   E+++FF  FG ++  ++  D+ K + KG
Sbjct: 82  FVGNIGFKVRARELKDFFGYFGDVVYAQIIMDRVKKRSKG 121


>SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07)
          Length = 97

 Score = 33.5 bits (73), Expect = 0.15
 Identities = 12/35 (34%), Positives = 23/35 (65%)
 Frame = +3

Query: 288 DEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           ++IR+ F ++GTI +V +  DK   + +G C++ F
Sbjct: 37  EDIRSAFEQYGTIEDVWVVKDKATKENRGVCYVKF 71



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 20/63 (31%), Positives = 28/63 (44%)
 Frame = +1

Query: 49  KELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPK 228
           +++R  F  YG IE + V  D  T  +RG  ++ F    S    +A  E    N   DPK
Sbjct: 37  EDIRSAFEQYGTIEDVWVVKDKATKENRGVCYVKFVKASS--AALACEEMDGRNIGDDPK 94

Query: 229 KAK 237
             K
Sbjct: 95  PIK 97


>SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 389

 Score = 33.5 bits (73), Expect = 0.15
 Identities = 13/47 (27%), Positives = 27/47 (57%)
 Frame = +1

Query: 43  TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           + ++++  FG  G + S  +  D  TG+S G+AF+ +  P+  +K +
Sbjct: 39  SQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAV 85


>SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28)
          Length = 440

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K++ G L    T+K+L +    +G++  ++ K         G+A++VFK  +  D+ +AA
Sbjct: 4   KVYCGRLPATATEKDLENLVKVFGKVREVDFK--------EGYAYVVFKENKDADRAVAA 55

Query: 190 -GEHTINNKKVDPKKAK 237
                 +  K+  +KAK
Sbjct: 56  LNNSEFHGAKILMEKAK 72


>SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33)
          Length = 662

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV 335
           F+G L S + D ++   FS++GTILE+
Sbjct: 360 FIGNLPSGVKDADVNEVFSKYGTILEI 386


>SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1208

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = +1

Query: 76  YGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           YGEI ++N+  D  TG+ +GF F+ ++   S
Sbjct: 2   YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = +3

Query: 315 FGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           +G I+ V +  DK   ++KGFCF+ +E ++
Sbjct: 2   YGEIVNVNLVRDKKTGKQKGFCFLCYEDQR 31


>SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23)
          Length = 44

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = +1

Query: 76  YGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           YGEI ++N+  D  TG+ +GF F+ ++   S
Sbjct: 2   YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32



 Score = 31.9 bits (69), Expect = 0.45
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = +3

Query: 315 FGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           +G I+ V +  DK   ++KGFCF+ +E ++
Sbjct: 2   YGEIVNVNLVRDKKTGKQKGFCFLCYEDQR 31


>SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 184

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 15/48 (31%), Positives = 27/48 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           K+++G L    + +E+ + FG YG ++ + V  +P      GFAF +F
Sbjct: 33  KVYIGSLGDNASKREIENEFGYYGPLKDVWVARNP-----PGFAFCIF 75


>SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 558

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 3/61 (4%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVK---TDPNTGRSRGFAFIVFKAPESIDKV 180
           KL++G L    ++  +      +GEIE          PN G  RG+ F+ FK  E   K 
Sbjct: 388 KLWIGNLDKRLSEFNILKILQQFGEIEHFQFLFHGNGPNRGEPRGYCFVEFKKKEDARKA 447

Query: 181 M 183
           +
Sbjct: 448 L 448


>SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017)
          Length = 255

 Score = 31.5 bits (68), Expect = 0.59
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSR 132
           KLFVG +     +K+LR  F  YG+I  + +  D  TG+ +
Sbjct: 171 KLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHK 211



 Score = 28.7 bits (61), Expect = 4.2
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEV 335
           FVG +S    ++++R  FS FGTI E+
Sbjct: 217 FVGMISKHAKEEDLRVMFSPFGTIEEL 243


>SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35)
          Length = 1118

 Score = 31.1 bits (67), Expect = 0.78
 Identities = 11/34 (32%), Positives = 23/34 (67%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTD 111
           ++++G L + TT+ ++R  F +YG +  IN+K +
Sbjct: 4   RVYLGRLPYGTTEDDVRRFFRSYGRLRDINLKNN 37


>SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23)
          Length = 2386

 Score = 31.1 bits (67), Expect = 0.78
 Identities = 12/42 (28%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKT-KNQRKGF 377
           ++GGLS +++++ +   F++FG + +V +  D++ K+++ GF
Sbjct: 527 WIGGLSEDVTENVLLELFNKFGPVKDVVILRDESGKSRQSGF 568


>SB_11425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 339

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 1/71 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKE-LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           L+VGGL+  T  +E L + FG +GEIE I +    N       AF+ +K+   ++   A 
Sbjct: 249 LYVGGLTLHTKLEEWLWEEFGEWGEIEDIRIIPKKN------IAFVRYKS--RLNAEFAK 300

Query: 190 GEHTINNKKVD 222
           G+ +++   VD
Sbjct: 301 GDCSLSGAIVD 311


>SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07)
          Length = 694

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTD 111
           L V GLS  TT+++LR  F  YG +E+I +  D
Sbjct: 183 LGVFGLSLYTTERDLRPVFEKYGPVEAIQIVYD 215


>SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13)
          Length = 337

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKT 108
           +FVG L      K L+ +F  YGE+ES+  ++
Sbjct: 23  VFVGNLPLTLKKKALKKYFSKYGEVESVRFRS 54


>SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14)
          Length = 273

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 17/70 (24%), Positives = 30/70 (42%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFVG L ++ T +++ DHF   G   S  + T      S+G  F+         K +   
Sbjct: 76  LFVGNLPFDLTTEKVLDHFRCAGS-SSFRLLTKKTDNSSKGCGFLEIDDSIGYTKALNLH 134

Query: 193 EHTINNKKVD 222
              +  +K++
Sbjct: 135 HSYLGGRKIN 144


>SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1148

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 174
           +F+GGL     +  + + F   GEI SI +        +R F  + F A ES+D
Sbjct: 353 VFIGGLPESINEHIINEIFYVCGEITSIRISKGKGE-NARKFCHLRFGAKESVD 405


>SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 179

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 180
           R  +LFVG LS ET  ++L + F  YG++   ++KT         + FI ++ P   ++ 
Sbjct: 4   RGTQLFVGRLSKETKLRDLENVFYLYGKLLRCDLKT--------AYGFIEYEDPRDAEEA 55

Query: 181 M 183
           M
Sbjct: 56  M 56


>SB_43316| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 302

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = -2

Query: 121 LCLDLSLH*YSLFHRMLQNDHGAPYLWSPSSAHQQKVSR 5
           L +D  LH Y  F+R L  D+ A Y W  S   +++V+R
Sbjct: 153 LIVDTGLH-YQGFNRSLALDYFAKYAWDTSDGAEKEVTR 190


>SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 781

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 11/39 (28%), Positives = 23/39 (58%)
 Frame = +3

Query: 276 EISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           + +D+++R+ F  FG I  V++  D    + KG+ ++ F
Sbjct: 63  DFNDEDLRSKFESFGDIEYVQIVRDHKTRENKGYGYVKF 101


>SB_8368| Best HMM Match : VWA (HMM E-Value=0)
          Length = 771

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 4/73 (5%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAY--GEIESINVKTDPNTGR-SRGFAFIVFKAPESIDKVM 183
           LF   +   +TD  ++ HF  Y   E+ ++N+K D +  R  RG  FI      S +K+ 
Sbjct: 167 LFYARIVMYSTDASVKMHFNKYSGAEMNNVNIKRDIDELRLERGLTFIDKALKISAEKLF 226

Query: 184 A-AGEHTINNKKV 219
                  +N KKV
Sbjct: 227 TEKNGMRLNRKKV 239


>SB_40017| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 512

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 503 LCSGAIWFWCCTLHI 459
           LCS AIW WCC L +
Sbjct: 475 LCSMAIWRWCCRLFL 489


>SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 371

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 8/84 (9%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYG-EIESINVKTDPNTG-------RSRGFAFIVFKAPE 165
           K++ G L ++ T  EL+  F A    +  + +  +P          RSRGF F+ F  PE
Sbjct: 51  KVYAGNLPFKLTQDELKAVFEAESLTVTDVLIVKEPRNEFYQQQEPRSRGFGFVTFANPE 110

Query: 166 SIDKVMAAGEHTINNKKVDPKKAK 237
                +     ++N K+V  +  K
Sbjct: 111 DAQTAV----KSLNGKEVQGRTLK 130


>SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 672

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = -2

Query: 493 GPSGFGVARFTSTSFPPIVLL---GVLSKSFTTCSDSNVMKQKPFLWFFVLSK 344
           G +G G+ R++S S P        G +S S+T      V  ++ FL FFVL K
Sbjct: 385 GVNGSGITRYSSLSVPFYCKFSSHGDVSLSYTIKKSVPVWHEEKFLSFFVLYK 437


>SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0)
          Length = 3369

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = -1

Query: 500  CSGAIWFWCCTLHIDLLSTNCSFGSLKQIIYNL 402
            C  +   WC     D+L+T CS GS++ ++  L
Sbjct: 3061 CGPSSSVWCLDCRGDILATGCSDGSVEVVVARL 3093


>SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2388

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRG 135
           + E LF  GL+     K L++    YG I++I V  DP T  +RG
Sbjct: 139 QREVLF-SGLNDNVDKKFLQEICQKYGTIQTIKVYYDPQTKNTRG 182


>SB_41149| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 435

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 6/85 (7%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFG--AYGEIES---INVKTDPNTGRSRGFAFIVFKAPESI 171
           ++ +VG LS + T ++L  HFG  A   + S   + +  +  +G+S GF F+    P+ +
Sbjct: 5   KRFYVGNLSVKATREDLSHHFGLDATPYLRSSCWVELAVE-KSGKSLGFGFV--NVPKHL 61

Query: 172 -DKVMAAGEHTINNKKVDPKKAKAR 243
            D +M   +  + +K++  + A+ +
Sbjct: 62  ADHLMHLNQTKLFDKRITIEPARGK 86


>SB_19883| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 656

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/52 (30%), Positives = 21/52 (40%)
 Frame = +1

Query: 1   RHEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           R+ KLF G  SW    + +R  FG +  I   N K         G+    FK
Sbjct: 535 RNVKLFHGINSWNKISENVRHSFGFFVWITLSNRKRHKRYNNKYGYGVTAFK 586


>SB_7579| Best HMM Match : HEAT (HMM E-Value=0.0096)
          Length = 1276

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 15/41 (36%), Positives = 22/41 (53%)
 Frame = -2

Query: 463 TSTSFPPIVLLGVLSKSFTTCSDSNVMKQKPFLWFFVLSKG 341
           T TS+P ++LLG L +     S   V ++K  LW + L  G
Sbjct: 177 TKTSYPLLLLLGKLLELIPPLSGEIVEREK--LWHYCLQNG 215


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,198,696
Number of Sequences: 59808
Number of extensions: 330559
Number of successful extensions: 1038
Number of sequences better than 10.0: 80
Number of HSP's better than 10.0 without gapping: 901
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1021
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1596754500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -