SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20079
         (698 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_47415| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   6e-10
SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011)             29   2.7  
SB_48435| Best HMM Match : Ion_trans (HMM E-Value=1.7e-11)             29   3.6  
SB_44339| Best HMM Match : Leu_leader (HMM E-Value=2.4)                28   6.3  
SB_2596| Best HMM Match : Extensin_2 (HMM E-Value=0.083)               28   6.3  
SB_830| Best HMM Match : No HMM Matches (HMM E-Value=.)                28   8.4  

>SB_47415| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 584

 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 4/65 (6%)
 Frame = +3

Query: 285 GI*PEEDRAGMQEGVRVQ----GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQL 452
           GI  E D+  + +  + Q    GTVV+HPEYGE +QLQGDQR +  ++L +  L K +Q+
Sbjct: 520 GISDEYDKKKLVKAFKKQFACNGTVVDHPEYGECIQLQGDQRAHAQEFLLQIDLAKKDQI 579

Query: 453 KVHGF 467
           KVHGF
Sbjct: 580 KVHGF 584



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 19/27 (70%), Positives = 24/27 (88%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTT+QG+S EYD KK+V+A KK+FAC
Sbjct: 514 TLTTIQGISDEYDKKKLVKAFKKQFAC 540



 Score = 35.5 bits (78), Expect = 0.042
 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 3/32 (9%)
 Frame = +2

Query: 170 PFADAIKS---SEDDVQDGLVHVRIQQRNGRR 256
           PF DA K    S   VQ  ++HVRIQQRNGR+
Sbjct: 482 PFEDASKGDGESNTSVQRDVIHVRIQQRNGRK 513


>SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011)
          Length = 812

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 18/69 (26%), Positives = 28/69 (40%)
 Frame = -2

Query: 436 TKPDLVSHWQIFSRWSP*SCSTSPYSGCSTTVPCTRTPSCMPARSSSGHIPRKGLAP*SA 257
           TKP   +     +  +  +  T P   C+   P +  PSC        H PRK +A    
Sbjct: 644 TKPPTAAPTTAAATQAAPAAMTCPQPACAPQSPMSCMPSCPAYCCKRNHFPRKAMAK-KG 702

Query: 256 STPVSLLDT 230
           +T  ++ DT
Sbjct: 703 NTCPAICDT 711


>SB_48435| Best HMM Match : Ion_trans (HMM E-Value=1.7e-11)
          Length = 1496

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +3

Query: 369  EVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF*AALLKHNMSTLNMYYE 518
            +VL+    QR++  QW    G+V+P QL      A   +  M+ LN+  E
Sbjct: 1157 KVLEFVAIQRKDNNQWAIPGGMVEPGQLVTQALKAEFGEEAMAKLNVSQE 1206


>SB_44339| Best HMM Match : Leu_leader (HMM E-Value=2.4)
          Length = 493

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = -3

Query: 336 ARELLLACPHDLLQVIFRGKALHRSQRLRPFRC 238
           A+ LLL C   LL  + +G   H +QRL   RC
Sbjct: 135 AKALLLMCAKALLLTVPKGSITHGAQRLYYSRC 167


>SB_2596| Best HMM Match : Extensin_2 (HMM E-Value=0.083)
          Length = 896

 Score = 28.3 bits (60), Expect = 6.3
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = +1

Query: 316 CKKEFACKVRSWSTRSTARCCSFR 387
           C+K F C  RS++ R T+RCC  R
Sbjct: 503 CEKAFTCGHRSYNPR-TSRCCDGR 525


>SB_830| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1390

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = -2

Query: 166  ECVEILDGHTIERRVSLFQRNAAILRTQQYNC 71
            +C+E +D H ++  +  FQ     L T  Y C
Sbjct: 1181 KCIECVDPHALQFIIDAFQGQVYALSTHPYGC 1212


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,731,763
Number of Sequences: 59808
Number of extensions: 445865
Number of successful extensions: 1210
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1061
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1210
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1829596184
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -