SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20078
         (633 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23)                     62   4e-10
SB_8792| Best HMM Match : No HMM Matches (HMM E-Value=.)               30   1.8  
SB_56987| Best HMM Match : Cornifin (HMM E-Value=1.5)                  27   9.6  

>SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23)
          Length = 940

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 30/73 (41%), Positives = 45/73 (61%)
 Frame = +1

Query: 34  DVRQTAAVLLRRLFSAXXXXXXXXXXXXQQTVLREQLLLTLQMDLSQYLRRKVCDVVSEL 213
           +VRQ AAVLLRR+F+A            Q  +++E LL  +  +    +R+K+CD VSEL
Sbjct: 27  EVRQMAAVLLRRIFTATVDFLKKIDENTQN-LMKESLLKGIHEEQDSNVRKKICDAVSEL 85

Query: 214 ARNHIDDDGNNQW 252
           +++ +DDDG N W
Sbjct: 86  SKSFLDDDGYNHW 98



 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 30/71 (42%), Positives = 43/71 (60%)
 Frame = +3

Query: 255 EFLQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMALR 434
           E L+F+F C ++    +KE+ + +F S PGVFGN+Q   L+VIK ML   +    S A+R
Sbjct: 100 ELLKFLFECCNSPRAELKESALNIFCSFPGVFGNQQDHYLNVIKQMLWQCINDQTSQAVR 159

Query: 435 TQAVKAVGAFI 467
             A +A  AFI
Sbjct: 160 FVAARASCAFI 170


>SB_8792| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1045

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 16/60 (26%), Positives = 34/60 (56%)
 Frame = +1

Query: 169 SQYLRRKVCDVVSELARNHIDDDGNNQWPSSYSSCLPVPVRKIQTSKKLVLECLRLYQVY 348
           ++Y+   VC     +++  I  +G+ Q PS+ ++ +P P R++ T++KL    L +  V+
Sbjct: 710 TEYIESGVCPQTESMSQA-ISLNGSFQRPSTSNTSVPPPPRELSTNEKLQAGGLAIIVVF 768


>SB_56987| Best HMM Match : Cornifin (HMM E-Value=1.5)
          Length = 752

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 14/53 (26%), Positives = 24/53 (45%)
 Frame = +1

Query: 160 MDLSQYLRRKVCDVVSELARNHIDDDGNNQWPSSYSSCLPVPVRKIQTSKKLV 318
           M +S+ LRR   D   E+ R+ ++D G    P S      +  ++   SK  +
Sbjct: 674 MKMSERLRRASDDTCDEMRRSRLEDSGIGMTPGSAQKSTGLQEKRSGKSKSKI 726


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,890,840
Number of Sequences: 59808
Number of extensions: 403743
Number of successful extensions: 828
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 775
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 827
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1584657875
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -