SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20076
         (660 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_31706| Best HMM Match : Tropomyosin (HMM E-Value=2.7)               30   1.5  
SB_13090| Best HMM Match : Atrophin-1 (HMM E-Value=1.8)                30   1.9  
SB_31961| Best HMM Match : EGF (HMM E-Value=0)                         29   2.5  
SB_11059| Best HMM Match : KID (HMM E-Value=0.046)                     29   2.5  
SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   2.5  
SB_41535| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.5  
SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034)               29   2.5  
SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06)                   29   3.4  
SB_25121| Best HMM Match : Hc1 (HMM E-Value=0.12)                      29   4.4  
SB_24734| Best HMM Match : Hexapep (HMM E-Value=2.9)                   29   4.4  
SB_23181| Best HMM Match : Hexapep (HMM E-Value=4.5e-09)               29   4.4  
SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.4  
SB_56580| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_41321| Best HMM Match : Hexapep (HMM E-Value=0.01)                  28   5.9  
SB_4107| Best HMM Match : M (HMM E-Value=8e-22)                        28   5.9  
SB_23964| Best HMM Match : Hexapep (HMM E-Value=1.2e-05)               28   5.9  
SB_22570| Best HMM Match : Filament (HMM E-Value=0.1)                  28   7.7  
SB_17752| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.7  

>SB_31706| Best HMM Match : Tropomyosin (HMM E-Value=2.7)
          Length = 275

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 24/96 (25%), Positives = 48/96 (50%), Gaps = 4/96 (4%)
 Frame = +2

Query: 212 RNAGAERQTDSSTR*VEMRVERLRKDTVR---IEEEKDSLLSTLDSIKHSELLLDISECD 382
           +  GAER+  +STR   +  +RLR    R   + +++ +  + L  ++H +L+ D   C+
Sbjct: 47  KRQGAERRLHNSTRAANILRDRLRIRQERLALVHQQRATAEARLQILRHDKLVND-EACN 105

Query: 383 KDDITRYADRILSRAMTVEV-TVRTDRDHQQEEALY 487
             +I+   +    R + VE+  V  D +  +EE  +
Sbjct: 106 NLEISHKQEPERRRKLQVELYRVIRDNERIKEETAF 141


>SB_13090| Best HMM Match : Atrophin-1 (HMM E-Value=1.8)
          Length = 988

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 11/21 (52%), Positives = 19/21 (90%)
 Frame = +2

Query: 305 EEKDSLLSTLDSIKHSELLLD 367
           E +DSL+S++D+++HSE+L D
Sbjct: 575 EAQDSLVSSMDTLRHSEMLND 595


>SB_31961| Best HMM Match : EGF (HMM E-Value=0)
          Length = 2813

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%)
 Frame = -2

Query: 527  CTD-ITSYRCTCSPD-TELPPADGLGQCALSPLRS*PGTGCGPRI 399
            CTD I  +RCTC P  T       + +CA +P ++  G  C  RI
Sbjct: 1275 CTDRINGFRCTCKPGFTGKDCGTEIDECASNPCKN--GATCTDRI 1317


>SB_11059| Best HMM Match : KID (HMM E-Value=0.046)
          Length = 296

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 22/94 (23%), Positives = 41/94 (43%)
 Frame = +2

Query: 194 RRILGSRNAGAERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDIS 373
           +R L  ++   E Q D+ T   ++ +E L ++   + ++  S  S    I+  E  L + 
Sbjct: 140 KRALQDQDQVMEEQQDALTE-RQLEIESLTEELRTLTDQNTSTNSLSAEIRRLEGTLSVY 198

Query: 374 ECDKDDITRYADRILSRAMTVEVTVRTDRDHQQE 475
             +KD + R  D +      +EV+  T    Q E
Sbjct: 199 IKEKDQLQRELDALRKTEAGIEVSKLTTTSSQVE 232


>SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3297

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 13/37 (35%), Positives = 25/37 (67%)
 Frame = +2

Query: 266  RVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISE 376
            RV+++  D +R   + ++L+S ++ I+HS L + ISE
Sbjct: 1492 RVDKVIVDQLREHSKVETLVSRIERIRHSPLHISISE 1528


>SB_41535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 247

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 308 EKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVRTD 457
           +KD+LL  +D +    LL D+ + DKD +    D +    +  +V V  D
Sbjct: 23  DKDTLLDNVDVVDGDTLLDDVDDVDKDTLLDDVDVVDKETLLDDVDVVED 72


>SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034)
          Length = 671

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 4/70 (5%)
 Frame = +2

Query: 188 PHRRILGSRNAGAERQTDSSTR*VEMRVERLRKDTVRIEEEKD--SLLSTLDSIK--HSE 355
           P ++ILGS +      +D+ TR VE+R  R R + +R E E D  SL +T+D +K  +  
Sbjct: 149 PVKKILGSMDL--HMNSDAVTR-VELR--RTRLELIRQEYEDDIVSLQNTIDRLKIENKR 203

Query: 356 LLLDISECDK 385
           L   ISE DK
Sbjct: 204 LHERISEQDK 213


>SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06)
          Length = 1223

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 24/104 (23%), Positives = 43/104 (41%)
 Frame = +2

Query: 179 TTTPHRRILGSRNAGAERQTDSSTR*VEMRVERLRKDTVRIEEEKDSLLSTLDSIKHSEL 358
           T TP R +   R++  E          E ++  LR+   R+EE +  L +     +  +L
Sbjct: 167 TITPFRHVASPRSSQLESLQRELAEKHESQLNELREQRARLEELQQQLSAEQAKQREQQL 226

Query: 359 LLDISECDKDDITRYADRILSRAMTVEVTVRTDRDHQQEEALYQ 490
           LL+    +K        + L +A   E   R  R  +++E L +
Sbjct: 227 LLE----EKQKTVTEEQQKLIQAQIDEQRERQKRLQEEQERLQE 266


>SB_25121| Best HMM Match : Hc1 (HMM E-Value=0.12)
          Length = 320

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +2

Query: 278 LRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITR 400
           LRKDTV+ E+     + T+ + K + L +D  + +K D+ R
Sbjct: 24  LRKDTVKAEKGNVLRIDTVKAEKGNVLRIDTVKAEKGDVLR 64


>SB_24734| Best HMM Match : Hexapep (HMM E-Value=2.9)
          Length = 459

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 308 EKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVRTD 457
           +KD+LL  +D +    LL D+ + DKD +    D +    +  +V V  D
Sbjct: 23  DKDTLLDNVDVVDGDTLLDDVDDVDKDTLLDDVDVVDKDTLLDDVDVVED 72


>SB_23181| Best HMM Match : Hexapep (HMM E-Value=4.5e-09)
          Length = 782

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 308 EKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVRTD 457
           +KD+LL  +D +    LL D+ + DKD +    D +    +  +V V  D
Sbjct: 23  DKDTLLDNVDVVDGDTLLDDVDDVDKDTLLDDVDVVDGDTLLDDVDVVED 72


>SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2193

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +2

Query: 272  ERLRKDTVRIEEEKDSLLSTLDSIKH 349
            ERL+KD   +++E  SL   LD++KH
Sbjct: 1177 ERLKKDNSALQKEVSSLKIQLDALKH 1202


>SB_56580| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1092

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 4/78 (5%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEE-KDSLLSTLDSIKHSELLLDISE---CDKDDITRYADRILSR 424
           +E   E    DT+  +E  +D LL  +   K  E LL  S+      D+I R A+ +L++
Sbjct: 451 LENLAESCEXDTITPDEILRDRLLFGIHDTKVRERLLRESKLTLAKTDEICRAAESMLAQ 510

Query: 425 AMTVEVTVRTDRDHQQEE 478
              V+ T  TD +  Q+E
Sbjct: 511 MKIVKDTSETDVNAMQQE 528


>SB_41321| Best HMM Match : Hexapep (HMM E-Value=0.01)
          Length = 1171

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 308 EKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVRTD 457
           +KD+LL  +D +    LL D+ + DKD +    D +    +  +V V  D
Sbjct: 217 DKDTLLDDVDVVDGDTLLDDVDDVDKDTLLDDVDVVDKDTLLDDVDVVDD 266


>SB_4107| Best HMM Match : M (HMM E-Value=8e-22)
          Length = 2039

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +2

Query: 260  EMRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADR 412
            E     L +  VR+E++K +L +TLD I+  +L  D +     D     DR
Sbjct: 1787 EQEKRELERAHVRLEKDKKALRNTLDKIEREKLETDETNTRLRDDRERLDR 1837


>SB_23964| Best HMM Match : Hexapep (HMM E-Value=1.2e-05)
          Length = 1482

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/50 (30%), Positives = 25/50 (50%)
 Frame = +2

Query: 308 EKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVEVTVRTD 457
           +KD+LL  +D +    LL D+ + DKD +    D +    +  +V V  D
Sbjct: 23  DKDTLLDDVDVVDGDTLLDDVDDVDKDTLLDDVDVVDKDTLLDDVDVVED 72


>SB_22570| Best HMM Match : Filament (HMM E-Value=0.1)
          Length = 601

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +2

Query: 263 MRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITR 400
           ++ ++ ++    +EEEKD L + LDS   +E L  +S C +D + R
Sbjct: 321 VKADQYKQHIADLEEEKDQLQNELDS--QTEELRQVSLCLEDAMKR 364


>SB_17752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 513

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +2

Query: 263 MRVERLRKDTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITR 400
           ++ ++ ++    +EEEKD L + LDS   +E L  +S C +D + R
Sbjct: 12  VKADQYKQHIADLEEEKDQLQNELDS--QTEELRQVSLCLEDAMKR 55


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,065,589
Number of Sequences: 59808
Number of extensions: 451152
Number of successful extensions: 1448
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 1215
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1446
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1693527500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -