SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20075
         (715 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.)              34   0.100
SB_13378| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.30 
SB_47389| Best HMM Match : 7tm_1 (HMM E-Value=0)                       31   0.93 
SB_51256| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.6  
SB_32088| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.6  
SB_48450| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.1  
SB_49936| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.8  
SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.9  
SB_52395| Best HMM Match : TP2 (HMM E-Value=7.8)                       29   4.9  
SB_15913| Best HMM Match : zf-B_box (HMM E-Value=5.4e-11)              29   4.9  
SB_6523| Best HMM Match : zf-B_box (HMM E-Value=4.4e-11)               29   4.9  
SB_24312| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.5  
SB_13920| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.5  
SB_13424| Best HMM Match : Pox_A32 (HMM E-Value=0.073)                 28   8.6  
SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12)               28   8.6  

>SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2124

 Score = 34.3 bits (75), Expect = 0.100
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = -3

Query: 698 IAWASLSATNEDKVSEISSTPRA*RHLRPLISCSIMKIASCTC 570
           I W +    N+ KV   + TP + R L P+ S  I+K+A  TC
Sbjct: 768 ITWKTYPDDNKKKVFRYTGTPNSYRLLTPIHSARIIKVAPLTC 810


>SB_13378| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 32.7 bits (71), Expect = 0.30
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 4/97 (4%)
 Frame = -2

Query: 585 SFVHLFSWHELGVGRKSFDGAKT-LAMLCKVSTCAWAKTTMVACTKSSPSSPNCCLGTKS 409
           ++VH+F   E G G + +  +K   ++  + +  +  K T + C  +      CC G  S
Sbjct: 76  TYVHMF---ESGTGSEGYKNSKRGSSVAAQQAALSLVKVTQICCAFNFKEFDQCCHGDGS 132

Query: 408 QNSVMA-FRLSVCGCTDCW--QTICEAICSLYSMRVT 307
           Q  ++A         +D W  Q  C  + + Y   VT
Sbjct: 133 QQYLLASAEKDETSSSDTWSNQPYCLEMTAFYRQTVT 169


>SB_47389| Best HMM Match : 7tm_1 (HMM E-Value=0)
          Length = 341

 Score = 31.1 bits (67), Expect = 0.93
 Identities = 22/76 (28%), Positives = 32/76 (42%)
 Frame = -2

Query: 633 RLKALEAVDQLQHHEDSFVHLFSWHELGVGRKSFDGAKTLAMLCKVSTCAWAKTTMVACT 454
           R++  E       H  S     S HE    R+S   AKT+A++       W   T+V+C 
Sbjct: 226 RIRGHEYSTDYNGHALSTNGTMSGHERKSIRRSIKAAKTIAIIVSAFLLCWMPYTLVSC- 284

Query: 453 KSSPSSPNCCLGTKSQ 406
            +S   P C   T S+
Sbjct: 285 -ASVICPPCFHRTPSE 299


>SB_51256| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 710 SGTCIAWASLSATNEDKVSEISS-TPRA*RHLRPLISCSIMKIASCT 573
           SG+   W  L  +N+  V  I + TP    H+  L  C I ++ +CT
Sbjct: 106 SGSIAQWYGLRFSNKRPVVRIQTYTPMTPNHITTLYPCMIKRLPTCT 152


>SB_32088| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 710 SGTCIAWASLSATNEDKVSEISS-TPRA*RHLRPLISCSIMKIASCT 573
           SG+   W  L  +N+  V  I + TP    H+  L  C I ++ +CT
Sbjct: 106 SGSIAQWYGLRFSNKRPVVRIQTYTPMTPNHITTLYPCMIKRLPTCT 152


>SB_48450| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 457

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 2/69 (2%)
 Frame = -2

Query: 558 ELGVGRKSFDGAKTLAMLCKV-STCAWAKTTMVACTKSSPSSPNCCLGTKSQN-SVMAFR 385
           E G+G    D      ++C   S C    TT+++   S   +  C LG  S   S+ A +
Sbjct: 255 EKGLGESGHDNKAVKFIMCNYDSDCRDNVTTILSVKTSFDKADQCMLGVSSNTLSITAMQ 314

Query: 384 LSVCGCTDC 358
           +++ G   C
Sbjct: 315 IAIYGKNFC 323


>SB_49936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 526

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 5/52 (9%)
 Frame = +3

Query: 168 TMQPSLRGLKACT-NLRWSDFTVQP-KSSVKPAGEYSVRPCG---TPIVRST 308
           T++P    L+ C   LR   +T++P + +++P   Y++RPCG    P+VR+T
Sbjct: 292 TLRPCRYTLRPCRYTLRPRRYTLRPCRYTLRPC-RYTLRPCGYTLRPVVRNT 342


>SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 362

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%)
 Frame = -2

Query: 372 GCTDCWQTICEA-ICSLYSMRVT 307
           GCTDC + +CEA I S   MR T
Sbjct: 108 GCTDCGELVCEACIASHKRMRAT 130


>SB_52395| Best HMM Match : TP2 (HMM E-Value=7.8)
          Length = 149

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%)
 Frame = +3

Query: 465 PSWFWP-KHRWTPYKAWPKSSLRRSSFDQLPTR 560
           P  FWP KHR  P K WP  ++  ++ +  P +
Sbjct: 70  PRKFWPPKHRALPRKFWPSKNIALTTENLAPKK 102



 Score = 28.3 bits (60), Expect = 6.5
 Identities = 11/19 (57%), Positives = 12/19 (63%), Gaps = 1/19 (5%)
 Frame = +3

Query: 474 FWP-KHRWTPYKAWPKSSL 527
           FWP KHR  P K WPK  +
Sbjct: 121 FWPQKHRALPRKFWPKKQI 139


>SB_15913| Best HMM Match : zf-B_box (HMM E-Value=5.4e-11)
          Length = 116

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%)
 Frame = -2

Query: 372 GCTDCWQTICEA-ICSLYSMRVT 307
           GCTDC + +CEA I S   MR T
Sbjct: 21  GCTDCGELVCEACIASHKRMRAT 43


>SB_6523| Best HMM Match : zf-B_box (HMM E-Value=4.4e-11)
          Length = 275

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%)
 Frame = -2

Query: 372 GCTDCWQTICEA-ICSLYSMRVT 307
           GCTDC + +CEA I S   MR T
Sbjct: 21  GCTDCGELVCEACIASHKRMRAT 43


>SB_24312| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 787

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 10/37 (27%), Positives = 23/37 (62%)
 Frame = +1

Query: 493 GHLTKHGQSLRSVEALSTNSQLVPTEQVHEAIFMMLQ 603
           GH ++  +SL S  A++ N + + T ++H++   +L+
Sbjct: 658 GHASEQKESLASNRAITKNGRFINTPKIHKSAMTLLR 694


>SB_13920| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 407

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +1

Query: 478 GPSTGGHLTKHGQSLRSVEALSTNSQLVPTE 570
           GP+   H+TKH + +   + L  N +L+P E
Sbjct: 353 GPARMEHVTKHRRMIEIEQILEQNGKLIPQE 383


>SB_13424| Best HMM Match : Pox_A32 (HMM E-Value=0.073)
          Length = 1387

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 15/43 (34%), Positives = 21/43 (48%)
 Frame = -2

Query: 525 AKTLAMLCKVSTCAWAKTTMVACTKSSPSSPNCCLGTKSQNSV 397
           A  L  LC  STCA   T  V+   +   +P   LG K++ +V
Sbjct: 676 ATRLRTLCAYSTCARTHTMSVSDKLNPQRTPRIPLGLKAERTV 718


>SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12)
          Length = 203

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 1/23 (4%)
 Frame = -2

Query: 372 GCTDCWQTICEAICSLYS-MRVT 307
           GCTDC + +CEA  + +  MR T
Sbjct: 108 GCTDCGELVCEACIACHKRMRAT 130


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,105,375
Number of Sequences: 59808
Number of extensions: 523144
Number of successful extensions: 1570
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1390
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1569
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1889780269
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -