SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20072
         (691 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.)              41   8e-04
SB_42238| Best HMM Match : Trypsin (HMM E-Value=0)                     41   8e-04
SB_29362| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_31634| Best HMM Match : Peptidase_M2 (HMM E-Value=0)                36   0.023
SB_49475| Best HMM Match : Syntaxin (HMM E-Value=8.5)                  35   0.071
SB_3851| Best HMM Match : TSP_1 (HMM E-Value=3.7e-24)                  29   2.7  

>SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1049

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 17/60 (28%), Positives = 32/60 (53%)
 Frame = +2

Query: 500 IPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNA 679
           +  L   ++ M   Y+T K+C     +   +SL+P++  + S S++ +EL  AW  W +A
Sbjct: 249 VARLQSLITNMTEIYSTGKVCLNITRNNTCMSLDPDLGNLMSRSRNQDELVWAWRGWRDA 308


>SB_42238| Best HMM Match : Trypsin (HMM E-Value=0)
          Length = 657

 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 17/60 (28%), Positives = 32/60 (53%)
 Frame = +2

Query: 500 IPSLMRTVSGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNA 679
           +  L   ++ M   Y+T K+C     +   +SL+P++  + S S++ +EL  AW  W +A
Sbjct: 533 VARLQSLITNMTEIYSTGKVCLNITRNNTCMSLDPDLGNLMSRSRNQDELVWAWRGWRDA 592


>SB_29362| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 587

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 1/68 (1%)
 Frame = +2

Query: 485 SA*RQIPSLMRTVSG-MESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAW 661
           S+ + +   +  V G M+  Y + K+    + SK  LSL+P + +I S S+D E LK  W
Sbjct: 108 SSDKDVQKTLNDVEGKMDQIYGSGKVID-TDGSK--LSLDPHLYKILSNSRDYERLKFVW 164

Query: 662 VEWHNAAG 685
             W +A G
Sbjct: 165 KGWRDATG 172



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 288 RASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQDFQDFTLRRM 452
           ++S A W Y +N+T EN  K  Q  L  S   + A ++ K +      + T R++
Sbjct: 45  KSSEASWNYATNLTVENLNKRTQASLTYSAFLEEARKKAKKFDLTKLSNDTRRQI 99


>SB_31634| Best HMM Match : Peptidase_M2 (HMM E-Value=0)
          Length = 663

 Score = 36.3 bits (80), Expect = 0.023
 Identities = 18/54 (33%), Positives = 31/54 (57%)
 Frame = +2

Query: 524 SGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           S M   Y++AK+ +    +  +LSL P++TE+ + S++  EL  AW +W    G
Sbjct: 123 SEMTEIYSSAKVTNPAIGT--NLSLNPQLTELMANSRNSPELLAAWRDWRQVTG 174


>SB_49475| Best HMM Match : Syntaxin (HMM E-Value=8.5)
          Length = 200

 Score = 34.7 bits (76), Expect = 0.071
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = +2

Query: 524 SGMESNYATAKICSYKNESKCDLSLEPEITEIFSTSQDPEELKHAWVEWHNAAG 685
           S M+  Y++ K+     E    LSL P++ +I + S+D E L   W  W +A G
Sbjct: 123 SQMDKIYSSGKVKDANGEM---LSLNPDLYKILAESRDYERLLFVWKGWRDAVG 173


>SB_3851| Best HMM Match : TSP_1 (HMM E-Value=3.7e-24)
          Length = 429

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%)
 Frame = +2

Query: 560 CSYKNESKCDLSLEPEITEIFSTSQD-PEELKHAWVEWHNAAG 685
           CS K+ S CDL  +P+ + +  TSQ+ P+ +   W +     G
Sbjct: 179 CSDKDTSACDLRTKPQSSTVCGTSQECPKWIIGNWSQCSRTCG 221


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,120,285
Number of Sequences: 59808
Number of extensions: 412656
Number of successful extensions: 1158
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1027
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1158
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1793485733
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -