SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20070
         (639 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_53726| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.2  
SB_19793| Best HMM Match : TSP_1 (HMM E-Value=0.0027)                  28   5.6  
SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)                 27   9.7  

>SB_53726| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 837

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = +1

Query: 313 QSVRSGSTGPGSFH*IQV*CRSTYGTCWPECC*CHCQGLP 432
           QS+ +GS  P S     V C S   +C   C  CHC+  P
Sbjct: 640 QSIDAGSEVPKSAKKQSVSCVSVASSCLEICRICHCEAEP 679


>SB_19793| Best HMM Match : TSP_1 (HMM E-Value=0.0027)
          Length = 384

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +2

Query: 419 AKVFPPSTHSSALIVCGPGNNGGDGLVAARICSCSDTMYRYI 544
           A + PPST +  ++ CGPG   G+  V A +     T  R +
Sbjct: 304 ATIKPPSTKTCNVVDCGPGWEKGEWSVCAGVPGQQGTSTRSV 345


>SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)
          Length = 1565

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 3/51 (5%)
 Frame = +2

Query: 194  FLNVIVQVVRECSNIACSKTDNI---GTMTSSMNQCNTVTRYLNQSEAAAL 337
            FLNV+  V R   N+  + T ++   G +T  +N    VTR+LN  E A +
Sbjct: 866  FLNVLSNVTRFL-NVPGNVTGSLNVLGNVTGFLNVLGNVTRFLNVPEKAKI 915


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,132,075
Number of Sequences: 59808
Number of extensions: 399765
Number of successful extensions: 1021
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 923
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1014
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1608851125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -