SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20069
         (636 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)                      164   6e-41
SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)                       130   7e-31
SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)                      129   2e-30
SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)             127   7e-30
SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36)                 87   1e-17
SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   8e-06
SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07)                 36   0.028
SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)                 36   0.028
SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23)                    32   0.45 
SB_42147| Best HMM Match : Thioredoxin (HMM E-Value=0.3)               29   4.2  
SB_23535| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.5  
SB_45801| Best HMM Match : DUF577 (HMM E-Value=3.8)                    28   5.5  
SB_44193| Best HMM Match : 7tm_1 (HMM E-Value=4.4e-12)                 28   7.3  
SB_21445| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_9096| Best HMM Match : Acid_phosphat_A (HMM E-Value=0.18)           27   9.7  
SB_493| Best HMM Match : No HMM Matches (HMM E-Value=.)                27   9.7  
SB_44478| Best HMM Match : Na_H_Exchanger (HMM E-Value=0)              27   9.7  
SB_34372| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_33710| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_23753| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  

>SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1327

 Score =  164 bits (398), Expect = 6e-41
 Identities = 75/87 (86%), Positives = 83/87 (95%)
 Frame = +2

Query: 245 RQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGD 424
           R+E+++K +GTVIGIDLGTTYSCVGV+KNGRVEIIANDQGNRITPSYVAFT++GERLIGD
Sbjct: 693 RKEQREK-VGTVIGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGD 751

Query: 425 AAKNQLTTNPENTVFDAKRLIGREWSD 505
            AKNQLTTNPENTVFDAKRLIGR W D
Sbjct: 752 GAKNQLTTNPENTVFDAKRLIGRSWDD 778



 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 30/43 (69%), Positives = 35/43 (81%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ+D+KFFPFKVV+KN KPHVQV+     K FA EEISAMVL
Sbjct: 780 SVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVL 822


>SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 640

 Score =  130 bits (315), Expect = 7e-31
 Identities = 60/75 (80%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV++NG+VEIIANDQGNR TPSYV FT D ERL+GDAAKNQ+  NPEN
Sbjct: 7   IGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFT-DTERLVGDAAKNQVALNPEN 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR + D
Sbjct: 66  TIFDAKRLIGRRYDD 80



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 23/43 (53%), Positives = 31/43 (72%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           TVQ D+K +PFK++  N+KP +QV+     K FA EEIS+MVL
Sbjct: 82  TVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEISSMVL 124


>SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1097

 Score =  129 bits (311), Expect = 2e-30
 Identities = 60/75 (80%), Positives = 69/75 (92%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           +GIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAF+ D ERLIGDAAKNQ+  NPEN
Sbjct: 7   VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFS-DTERLIGDAAKNQVAMNPEN 65

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++ D
Sbjct: 66  TVFDAKRLIGRKFDD 80



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 27/44 (61%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P V  D+  +PF V+ +  +P +QV+     K F PEEIS+MVL
Sbjct: 81  PVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEISSMVL 124


>SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 746

 Score =  127 bits (307), Expect = 7e-30
 Identities = 59/75 (78%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+++G+VEIIANDQGNR TPSYVAFT D ERL+GDAAKNQ+  NP N
Sbjct: 7   IGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFT-DEERLVGDAAKNQVAMNPTN 65

Query: 461 TVFDAKRLIGREWSD 505
           T+FDAKRLIGR + D
Sbjct: 66  TIFDAKRLIGRRFDD 80



 Score = 31.5 bits (68), Expect = 0.59
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +1

Query: 529 FFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           FF  +VV +  +P V+V+     K F  EEIS+MVL
Sbjct: 114 FFAEEVVNEAGRPKVKVEYKGETKTFFAEEISSMVL 149



 Score = 31.1 bits (67), Expect = 0.78
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEI 621
           P V+ D+K + F+VV +  +P V+V+     K F  EE+
Sbjct: 81  PGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEV 119


>SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36)
          Length = 437

 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 39/79 (49%), Positives = 59/79 (74%), Gaps = 2/79 (2%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYK--NGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTN 451
           +IGIDLGTTYSCVG Y+  +GR++I +++  +++ PS VAFT  G  L+G+ A +Q   N
Sbjct: 33  IIGIDLGTTYSCVGAYQAISGRIDIFSDENDDKVVPSLVAFTDKGV-LVGEKALSQAEIN 91

Query: 452 PENTVFDAKRLIGREWSDQ 508
           P+NT++DAKR IG+ ++ Q
Sbjct: 92  PKNTIYDAKRFIGKTFTKQ 110


>SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1068

 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 22/55 (40%), Positives = 35/55 (63%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQ 439
           +V+G D+G     + V + G +E +AN+  +R TPS+V+   D +RLIG + KNQ
Sbjct: 2   SVVGFDVGNQSCYIAVARGGGIETVANEFSDRCTPSFVSL-GDKQRLIGTSGKNQ 55



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMV 633
           P VQ ++   P+KVVE  N    +QVQ     +VF+PE++ AM+
Sbjct: 137 PAVQKEIPHLPYKVVELPNDSIGIQVQYLGKQEVFSPEQVMAML 180


>SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07)
          Length = 592

 Score = 35.9 bits (79), Expect = 0.028
 Identities = 17/30 (56%), Positives = 23/30 (76%)
 Frame = +2

Query: 329 NGRVEIIANDQGNRITPSYVAFTQDGERLI 418
           +G   IIAND G+R+TP+ VAF+ D E+LI
Sbjct: 82  DGNTTIIANDAGDRVTPAMVAFS-DTEKLI 110


>SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)
          Length = 212

 Score = 35.9 bits (79), Expect = 0.028
 Identities = 15/25 (60%), Positives = 20/25 (80%)
 Frame = +2

Query: 341 EIIANDQGNRITPSYVAFTQDGERL 415
           ++I N +G+R TPS VAFT +GERL
Sbjct: 7   KVIENAEGSRTTPSVVAFTPEGERL 31


>SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23)
          Length = 877

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +2

Query: 314 VGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDA 475
           V  Y N +V + A D G+++T  Y A T +G+ L+   A + +T N +  V  A
Sbjct: 728 VSDYHNRKVHVFARDDGSQVT-CYTAVTDEGDGLLN--APSGITVNSKGEVIVA 778


>SB_42147| Best HMM Match : Thioredoxin (HMM E-Value=0.3)
          Length = 787

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = -1

Query: 498 HSRPIRRLASKTVFSGLVVSWF 433
           H   I RL+S+ VFSG V+ WF
Sbjct: 114 HKILIDRLSSRFVFSGTVIQWF 135


>SB_23535| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 222

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 17/70 (24%), Positives = 34/70 (48%)
 Frame = +2

Query: 413 LIGDAAKNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHK 592
           ++ D+AK++  T  EN + D      R+WS  +         +RSL+    L+ + +   
Sbjct: 1   MVQDSAKDEKMTEAENDIDD------RKWSKPVMEKRRRERINRSLEELKRLVLEAQHRD 54

Query: 593 ATKYLLLKKS 622
            ++Y  L+K+
Sbjct: 55  CSRYTKLEKA 64


>SB_45801| Best HMM Match : DUF577 (HMM E-Value=3.8)
          Length = 443

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = -1

Query: 555 LFNDLEGEELNIMLYSWSLH 496
           LF  LEG+ +NI L +WSLH
Sbjct: 358 LFKFLEGKLININLRNWSLH 377


>SB_44193| Best HMM Match : 7tm_1 (HMM E-Value=4.4e-12)
          Length = 863

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 19/70 (27%), Positives = 32/70 (45%)
 Frame = +2

Query: 107 DLIVAVNIILFRFLLISESFNL*ILHGQDAVEFVRASFGGRGRLCRRQEEKDKDIGTVIG 286
           +L V  N++L   L  +++    ++    AV   RA F   G+LCR   +   DI  +  
Sbjct: 141 ELRVPANLLLVS-LAANDALTGLVIQPSHAVSLYRALFQPYGKLCRTDGKIFIDICAMFS 199

Query: 287 IDLGTTYSCV 316
           +  G T  C+
Sbjct: 200 LTSGLTSLCL 209


>SB_21445| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 11/27 (40%), Positives = 13/27 (48%)
 Frame = +1

Query: 286 YRFGYHLLMCRCLQKWTCRNHCQ*PGK 366
           Y     +L  RCL + TC  HC  P K
Sbjct: 63  YDIHQEILRARCLNEGTCVEHCDSPKK 89


>SB_9096| Best HMM Match : Acid_phosphat_A (HMM E-Value=0.18)
          Length = 417

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +2

Query: 251 EEKDKDIGTVIGIDLGT-TYSCVGVYKNGRVEIIANDQGN 367
           E +D+D G V G+DL T T      Y +G  + I N Q N
Sbjct: 180 ESQDRDTGDVAGVDLSTRTEQKNAKYADGYEKEIENAQTN 219


>SB_493| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 113

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 509 LYNMMLSSSPSRSLKRTANLMFKYKLHKATKYLLL 613
           L+  + + SP+RS   + N+MF Y L  +  +L L
Sbjct: 37  LFRKLTNHSPARSSIESGNMMFHYILENSVCFLTL 71


>SB_44478| Best HMM Match : Na_H_Exchanger (HMM E-Value=0)
          Length = 557

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 1/66 (1%)
 Frame = -1

Query: 312 HE*VVPKSIPITVPMSLSFSSCRRHKRPRPPKLARTNSTAS*PCKIY-RLKDSEINKNLN 136
           HE  V   I + V   + +S    HK+P   K+   N+  + P  ++  +  +E   NL 
Sbjct: 94  HETGVAMIIGVVVGALIKYSEVGHHKQPLSVKIKNCNNLTNAPQSVWVNINGTEYTYNLM 153

Query: 135 KIIFTA 118
            I F A
Sbjct: 154 GIRFPA 159


>SB_34372| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 252

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 509 LYNMMLSSSPSRSLKRTANLMFKYKLHKATKYLLL 613
           L+  + + SP+RS   + N+MF Y L  +  +L L
Sbjct: 37  LFRKLTNHSPARSSIESGNMMFHYILENSVCFLTL 71


>SB_33710| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 96

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 18/50 (36%), Positives = 24/50 (48%)
 Frame = -1

Query: 159 SEINKNLNKIIFTATIRSL*NAFIKHLRIQTVHRYFSFNCSRKTRDSSLL 10
           S +N NL  +  ++TIRSL  A    LR       F     RK RD+ +L
Sbjct: 12  SGVNDNLEVLPSSSTIRSLFEAKFCPLRPSPGGLVFRLRVERKLRDTGVL 61


>SB_23753| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 517

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 25/96 (26%), Positives = 37/96 (38%), Gaps = 1/96 (1%)
 Frame = -1

Query: 480 RLASKTVFSGLVVSWFLAASPIKRSPS*VKATYEGVM-RFPWSLAMISTRPFL*TPTHE* 304
           RL   T   G  ++    AS +  + +   AT   ++   P S     T+P   TP HE 
Sbjct: 349 RLELYTCKQGAAITTSTTASSVATTVTTTTATSSSMLPNTPSSSPSTGTQPSS-TPIHEP 407

Query: 303 VVPKSIPITVPMSLSFSSCRRHKRPRPPKLARTNST 196
               +  +T+  S S      H RP   K   T+ T
Sbjct: 408 PTQGTTLVTMETSTSHLKSSHHSRPTTRKTLFTSKT 443


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,276,283
Number of Sequences: 59808
Number of extensions: 431971
Number of successful extensions: 1008
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 931
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1001
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1596754500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -