SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20067
         (619 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_50335| Best HMM Match : Baculo_11_kDa (HMM E-Value=2.1)             29   4.0  
SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.0  
SB_28720| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.3  
SB_49336| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.0  
SB_42268| Best HMM Match : efhand (HMM E-Value=0.96)                   27   9.2  

>SB_50335| Best HMM Match : Baculo_11_kDa (HMM E-Value=2.1)
          Length = 370

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 256 NEDRPCPRDCICSVSQGYRQAK 321
           N  + CP  C C +S+GYR +K
Sbjct: 121 NVGKLCPSHCFCLLSRGYRASK 142


>SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1278

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 6/71 (8%)
 Frame = +1

Query: 241 PRGFVNED-RPCPRDCICSVSQGYRQAKCSF---LEIGTQKFGDDI--LDLVVENADPRY 402
           PRG  N    P  R C+C V   YR++  S    L +G    GD I    ++V    P+Y
Sbjct: 659 PRGSANSSCNPFTRQCLCKVVLTYRKSTDSTDSDLRLGDLS-GDTIAKTGILVVGVPPQY 717

Query: 403 PINLDDFMFKK 435
             N  D + +K
Sbjct: 718 VFNRFDRLARK 728


>SB_28720| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 672

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = +2

Query: 158 ESINKTVKKDKDADNLLDQYEDYEPAEYQEVLSTRTGPVPETAYALYLRDT 310
           E   K  +KD +   L  Q E  +P E QE++ T T  V E  Y ++ RDT
Sbjct: 335 EEDEKEQEKDDEGPKLQKQVETSKPGEEQEMV-TVTKVVEEIEYTIH-RDT 383


>SB_49336| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 95

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 1/29 (3%)
 Frame = +2

Query: 209 DQYEDYEPAEYQEVLSTRTGPVPET-AYA 292
           D+ +  +  E+QEV STR GPV +T AY+
Sbjct: 59  DEQQRMQMNEHQEVSSTRIGPVTKTNAYS 87


>SB_42268| Best HMM Match : efhand (HMM E-Value=0.96)
          Length = 610

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -2

Query: 531 TA*RSWTPGKHWGDITNRAVH 469
           T  R+W  GK+W  + NRA H
Sbjct: 495 TTLRAWRSGKNWLSVLNRAKH 515


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,572,514
Number of Sequences: 59808
Number of extensions: 369800
Number of successful extensions: 1136
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1054
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1136
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1524174750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -