SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_29018| Best HMM Match : No HMM Matches (HMM E-Value=.)              93   2e-19
SB_32739| Best HMM Match : PA (HMM E-Value=0.19)                       29   3.3  
SB_27469| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-08)                 28   7.5  
SB_59684| Best HMM Match : C1_3 (HMM E-Value=8.3)                      28   7.5  
SB_28212| Best HMM Match : C1_3 (HMM E-Value=0.59)                     28   7.5  

>SB_29018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1047

 Score = 92.7 bits (220), Expect = 2e-19
 Identities = 42/72 (58%), Positives = 51/72 (70%)
 Frame = +1

Query: 13   LNPYRHSDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVVTDSVRSKAKTFVK 192
            LNPY   D   GRIT   DFK+LARKLTH VM+KEL+H +S E L   DSV+ K K +++
Sbjct: 975  LNPYHKVDCKQGRITNVEDFKYLARKLTHGVMMKELQHVKSAESLQCNDSVKVKTKDYIR 1034

Query: 193  KYMAKFGPVYKR 228
             YM KFGPVY+R
Sbjct: 1035 SYMKKFGPVYQR 1046


>SB_32739| Best HMM Match : PA (HMM E-Value=0.19)
          Length = 319

 Score = 29.1 bits (62), Expect = 3.3
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +1

Query: 31  SDAPAGRITCTADFKHLARKLTHFVMLKELKHCRSVEELVV 153
           SDA    I    +   L RK  HFV  +ELK   SV  LV+
Sbjct: 59  SDAKTSAIKQEEENLELHRKAVHFVSAEELKETLSVISLVI 99


>SB_27469| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-08)
          Length = 341

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 9/21 (42%), Positives = 16/21 (76%)
 Frame = +3

Query: 177 EDFRQKIHGQVRSCVQTATRG 239
           EDF++++H +VR+C  +  RG
Sbjct: 255 EDFKRELHRKVRACYSSCMRG 275


>SB_59684| Best HMM Match : C1_3 (HMM E-Value=8.3)
          Length = 138

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = -3

Query: 344 RALARCVERCDVCCHMTLTCTNCYALIC 261
           R +A CV RC  CC   + C  C  + C
Sbjct: 34  RCVACCVMRCVACC--VMRCVGCCVMRC 59


>SB_28212| Best HMM Match : C1_3 (HMM E-Value=0.59)
          Length = 218

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = -3

Query: 344 RALARCVERCDVCCHMTLTCTNCYALIC 261
           R +A CV RC  CC   + C  C  + C
Sbjct: 114 RCVACCVMRCVACC--VMRCVGCCVMRC 139


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,390,163
Number of Sequences: 59808
Number of extensions: 396855
Number of successful extensions: 1073
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 995
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1068
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1645141000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -