SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20064
         (713 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_56532| Best HMM Match : DUF983 (HMM E-Value=0.47)                   30   2.1  
SB_7694| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-28)                  29   2.8  
SB_21647| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.7  
SB_47989| Best HMM Match : Filament (HMM E-Value=0.27)                 29   4.9  
SB_31982| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.6  
SB_22572| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   8.6  

>SB_56532| Best HMM Match : DUF983 (HMM E-Value=0.47)
          Length = 401

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 1/54 (1%)
 Frame = +3

Query: 231 LACSLTLSKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLAS-IAIVGLILN 389
           L  +L L++ + LW     P ++ G +T++  L  +LD  TLA+ I I+G+I++
Sbjct: 332 LTLTLILNRRISLWVALSIPFSLFGVITLLPQLGQVLDGYTLAAMILIIGIIVD 385


>SB_7694| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-28)
          Length = 329

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 3/39 (7%)
 Frame = -2

Query: 427 SWLHITGTIKSTKLRMR---PTIAIEARVLRSNNQMRRY 320
           S++ + G IK  KL++R   PT++ E  ++ S   ++RY
Sbjct: 191 SYIQVYGVIKKHKLQIRAMAPTVSTELEIITSPRNIKRY 229


>SB_21647| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 340

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 22/72 (30%), Positives = 34/72 (47%)
 Frame = +1

Query: 448 QDNTRRHLKKFVEAL**ATIIGDLHPFILFPTRYQPIYVLHYLHQYIVYCSLDILFY*QH 627
           +DNTR+     +EA    T +  L   I +   Y P  VL YL  + V CS   + + + 
Sbjct: 213 KDNTRKRRNSLIEAR--LTRVLSL-VLIAYLFCYGPSCVLIYLMNFCVECSCTQIHWFRD 269

Query: 628 FPVVFIVNSSTA 663
              VF++ +S A
Sbjct: 270 MQFVFVLTNSCA 281


>SB_47989| Best HMM Match : Filament (HMM E-Value=0.27)
          Length = 366

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 10/33 (30%), Positives = 22/33 (66%)
 Frame = -3

Query: 666 QSSTTVDNKYNRKMLLIEEDIQATVHNVLMEIV 568
           +S TT+      K+ L+E+D++ +++N+L  +V
Sbjct: 332 ESMTTLQKVLEAKLKLVEDDLKKSINNILRMVV 364


>SB_31982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 495

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%)
 Frame = +3

Query: 264 ILWEQQWHPCAIVGSMT---IMYLLIWLLDLNTLASIAIVGLIL 386
           +L+E   HP  I+ ++    +  LL  L+  N L  IAI+G+IL
Sbjct: 127 VLYESYIHPITILSTLPSAGVGALLALLISGNELGLIAIIGIIL 170


>SB_22572| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 537

 Score = 27.9 bits (59), Expect = 8.6
 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%)
 Frame = +3

Query: 561 CITLSPSVHCVL*LGYPLLLTT--FSCCI 641
           C+T++   HCV   GYP  +T    +CC+
Sbjct: 496 CVTMNGCAHCVTMNGYPRCVTMNGCTCCV 524


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,601,529
Number of Sequences: 59808
Number of extensions: 436267
Number of successful extensions: 987
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 927
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 984
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1889780269
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -