SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.)             143   1e-34
SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_11242| Best HMM Match : MAM (HMM E-Value=0)                         29   3.5  
SB_46368| Best HMM Match : DUF156 (HMM E-Value=6.5)                    28   6.1  
SB_27599| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.1  
SB_42549| Best HMM Match : Peptidase_A17 (HMM E-Value=1e-35)           28   8.0  
SB_38450| Best HMM Match : zf-CCHC (HMM E-Value=0.00018)               28   8.0  

>SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 687

 Score =  143 bits (347), Expect = 1e-34
 Identities = 65/75 (86%), Positives = 69/75 (92%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARGPKKH+KRLNAPK WMLDKL GV+APRPSTGPHKLRECLPL+IFLRNRLKYAL G E
Sbjct: 425 MARGPKKHMKRLNAPKHWMLDKLSGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALNGEE 484

Query: 220 VLKIVKQRLIKVMGK 264
           V KIVKQRLIK+ GK
Sbjct: 485 VKKIVKQRLIKIDGK 499



 Score =  143 bits (346), Expect = 1e-34
 Identities = 66/86 (76%), Positives = 73/86 (84%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD TYPAGFMDVV+I+KT E FRL+YDVKGRF +HRIT EEAKYKL +V+RV 
Sbjct: 495 KIDGKVRTDTTYPAGFMDVVTIDKTGENFRLLYDVKGRFAVHRITAEEAKYKLGRVRRVD 554

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKV 506
            G K VPY+VTHD RTIRYPDP IKV
Sbjct: 555 VGAKGVPYIVTHDARTIRYPDPNIKV 580



 Score = 74.1 bits (174), Expect = 9e-14
 Identities = 29/63 (46%), Positives = 46/63 (73%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D++ +DI T K++D+IKF++GN+ M+ GGRN+GRVG +    + +  FDIVH+K
Sbjct: 576 PNIKVNDTVVIDIKTGKVIDYIKFDTGNMAMVVGGRNMGRVGMVTHREKHAGSFDIVHVK 635

Query: 671 DST 679
           D+T
Sbjct: 636 DAT 638


>SB_49186| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1776

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 14/58 (24%), Positives = 27/58 (46%)
 Frame = +3

Query: 189 SSEVCFDRKRSPENCETTPHKGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGR 362
           SSE      +     E+T  +G G +   P+YP+  ++  ++  +N+LF    +   R
Sbjct: 594 SSEYWLMASQGQHVSESTLVRGRGDILISPSYPSALLETTTLITSNQLFNTFIESSTR 651


>SB_11242| Best HMM Match : MAM (HMM E-Value=0)
          Length = 348

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 2/28 (7%)
 Frame = +3

Query: 183 EES--SEVCFDRKRSPENCETTPHKGDG 260
           EES  +E+C DRKR P++CE     GDG
Sbjct: 76  EESRYNELCHDRKRGPDDCE---FDGDG 100


>SB_46368| Best HMM Match : DUF156 (HMM E-Value=6.5)
          Length = 203

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
 Frame = -2

Query: 182 RKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAF-KRFKCFLGPRAMLDK 30
           RK +R     N++G ++GLG+  PP  + I     F K  K F  PR    K
Sbjct: 60  RKRSRSLPRTNVFGTLNGLGSPPPPRDNRIDEYAEFTKSQKSFTFPRRSKQK 111


>SB_27599| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2937

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%)
 Frame = +3

Query: 150 VARVLAPGDFPEESSEVC-FDRKRSP--ENCETTPHKGDG 260
           VA    PGDF +++ E+C ++R +SP  + C  +P   DG
Sbjct: 70  VAEADRPGDF-QDAIEICSYERTKSPGVDECAASPCLNDG 108


>SB_42549| Best HMM Match : Peptidase_A17 (HMM E-Value=1e-35)
          Length = 1595

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 14/39 (35%), Positives = 20/39 (51%)
 Frame = +3

Query: 174 DFPEESSEVCFDRKRSPENCETTPHKGDGKVRTDPTYPA 290
           D  +E +E+  ++ RSP    T   K D  VRT  T P+
Sbjct: 111 DKEQERAELLSNKSRSPFKQATKSVKSDSSVRTSSTTPS 149


>SB_38450| Best HMM Match : zf-CCHC (HMM E-Value=0.00018)
          Length = 1066

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 14/39 (35%), Positives = 20/39 (51%)
 Frame = +3

Query: 174 DFPEESSEVCFDRKRSPENCETTPHKGDGKVRTDPTYPA 290
           D  +E +E+  ++ RSP    T   K D  VRT  T P+
Sbjct: 118 DKEQERAELLSNKSRSPFKQATKSVKSDSSVRTSSTTPS 156


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,074,341
Number of Sequences: 59808
Number of extensions: 537822
Number of successful extensions: 1333
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1215
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1328
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1757375282
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -