SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20062
         (635 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_21750| Best HMM Match : Dynamin_M (HMM E-Value=0)                  146   1e-35
SB_46217| Best HMM Match : No HMM Matches (HMM E-Value=.)             120   7e-28
SB_2557| Best HMM Match : No HMM Matches (HMM E-Value=.)               34   0.084
SB_17455| Best HMM Match : Ank (HMM E-Value=2.2)                       29   3.2  
SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031)                  29   3.2  
SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.5  
SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11)                 28   7.3  
SB_23766| Best HMM Match : 4_1_CTD (HMM E-Value=1.1)                   28   7.3  
SB_15237| Best HMM Match : NHL (HMM E-Value=0)                         28   7.3  
SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022)                   27   9.7  
SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11)                 27   9.7  
SB_48403| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_18285| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.7  
SB_17406| Best HMM Match : DUF433 (HMM E-Value=4.2)                    27   9.7  

>SB_21750| Best HMM Match : Dynamin_M (HMM E-Value=0)
          Length = 498

 Score =  146 bits (355), Expect = 1e-35
 Identities = 66/83 (79%), Positives = 79/83 (95%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           QI+ M+ +FI +E+CLILAV+PAN+DLANSDALK+A+EVDPQG RTIGVITKLDLMDEGT
Sbjct: 155 QIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMDEGT 214

Query: 439 DARDVLENKLLPLRRGYIGVVNR 507
           DARD+LEN++LPLRRGYIG+VNR
Sbjct: 215 DARDILENRVLPLRRGYIGIVNR 237



 Score =  134 bits (325), Expect = 4e-32
 Identities = 61/81 (75%), Positives = 70/81 (86%)
 Frame = +2

Query: 11  QLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLN 190
           QL    +EYAEFLHC+ KKFTDF EV+ EI AETDRVTG NKGIS +PINLRVYSP+VL+
Sbjct: 72  QLQPSKSEYAEFLHCRNKKFTDFGEVQKEIVAETDRVTGGNKGISNIPINLRVYSPSVLS 131

Query: 191 LTLIDLPGLTKVPIGDQPIDI 253
           LTL+DLPG+TKVP+GDQP DI
Sbjct: 132 LTLVDLPGMTKVPVGDQPADI 152



 Score = 68.1 bits (159), Expect = 6e-12
 Identities = 30/36 (83%), Positives = 34/36 (94%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DIDGRKDI AALAAERKFFLS+PSYRH+AD++GT
Sbjct: 239 QADIDGRKDIRAALAAERKFFLSNPSYRHMADKMGT 274


>SB_46217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 882

 Score =  120 bits (290), Expect = 7e-28
 Identities = 54/74 (72%), Positives = 63/74 (85%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           E+ +FLH K K F DFN +R EIE ETDRVTGSNKGIS  PINL++YSP VLNLTL+DLP
Sbjct: 140 EWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLP 199

Query: 212 GLTKVPIGDQPIDI 253
           G+TKVP+GDQP+DI
Sbjct: 200 GVTKVPVGDQPLDI 213



 Score =  110 bits (264), Expect = 1e-24
 Identities = 52/84 (61%), Positives = 66/84 (78%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           QQI+ +I Q+I   + +ILAVTPAN DLA S+ALK+A+EVDP G RT+ V TKLDLMD G
Sbjct: 215 QQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHG 274

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           TDA DVL  +++P++ G IGVVNR
Sbjct: 275 TDAMDVLYGRVIPVKLGIIGVVNR 298


>SB_2557| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 627

 Score = 34.3 bits (75), Expect = 0.084
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +1

Query: 334 DLANSDALKLAKEVDPQGLRTIGVITKLDLMDE 432
           D   S+   L   +DPQG RTI V+TK+DL ++
Sbjct: 160 DAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQ 192



 Score = 31.1 bits (67), Expect = 0.78
 Identities = 13/46 (28%), Positives = 24/46 (52%)
 Frame = +2

Query: 74  DFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           +  ++R E+E    R     + +SP  I++ V  P +  + L+DLP
Sbjct: 110 ELKDLRHEVELRMKRSVKQGQTVSPEVISMTVKGPGLHRMVLVDLP 155


>SB_17455| Best HMM Match : Ank (HMM E-Value=2.2)
          Length = 487

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 16/60 (26%), Positives = 26/60 (43%)
 Frame = +2

Query: 14  LINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNL 193
           L++   E+ + L   G    +F  V+   E     +  SN+ + P+       SPNV NL
Sbjct: 412 LLHDRVEFVDLLLDNGVSMANFLTVKRLEELYRKHLVSSNRSLGPLCARRATGSPNVTNL 471


>SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031)
          Length = 598

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +1

Query: 406 ITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNR 507
           I KLD  D  T+  + L N+L P +R YI V++R
Sbjct: 99  IDKLDFSDGTTNTLEDLYNELNPDKRSYIRVLSR 132


>SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 268

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%)
 Frame = +2

Query: 14  LINGNTEYAEFLHCKGKKFTDFNE-VRGEIEAETDRVTG 127
           ++  N E  +FLH   K++ DF E +  E     DRV G
Sbjct: 161 MVQANQEVPDFLHDMAKRYEDFRERMSAERGDRGDRVEG 199


>SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11)
          Length = 809

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 2/83 (2%)
 Frame = -3

Query: 267 FDLLPISIG*SPIGTFVRPGKSISVRLSTFGE*TRRLIGTGDIPLLEPVTRSV--SASIS 94
           FDL+        +  +   GKS++   S   +  +++  +G +   +P+T  V  S+ + 
Sbjct: 243 FDLVDYDTLIKKLSIYGVSGKSLNWFKSYLEDRKQKVTISGQLSDSQPITAGVPQSSILG 302

Query: 93  PRTSLKSVNFFPLQCKNSAYSVF 25
           P   +  +N  PL+  NSA  ++
Sbjct: 303 PLMFILFINDLPLEVSNSALEIY 325


>SB_23766| Best HMM Match : 4_1_CTD (HMM E-Value=1.1)
          Length = 69

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +1

Query: 307 ILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLD 420
           ++A    +TD A ++A++ A+E DP    T  VIT+ D
Sbjct: 28  VIATGDPDTDAAIAEAIRQAREADPNVKVTEVVITRND 65


>SB_15237| Best HMM Match : NHL (HMM E-Value=0)
          Length = 997

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 18/65 (27%), Positives = 32/65 (49%)
 Frame = +2

Query: 32  EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLP 211
           EYAE L  KG    +  ++  E++A   + +      SP+    +++SPN   L L+   
Sbjct: 534 EYAENLLEKGSTL-EICQLAEEVKANLQQQSSLEFVSSPLATKGKIFSPNTAFLDLLTTN 592

Query: 212 GLTKV 226
           G+ +V
Sbjct: 593 GIGRV 597


>SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022)
          Length = 270

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 19/83 (22%), Positives = 40/83 (48%), Gaps = 2/83 (2%)
 Frame = -3

Query: 267 FDLLPISIG*SPIGTFVRPGKSISVRLSTFGE*TRRLIGTGDIPLLEPVTRSV--SASIS 94
           FDL+      + +  +   GKS++   S   +  +++  +G +   +P+T  V  S+ + 
Sbjct: 31  FDLVDHDTLINKLSIYGVSGKSLNWFKSYLEDRKQKVTISGQLSDSQPITAGVPQSSILG 90

Query: 93  PRTSLKSVNFFPLQCKNSAYSVF 25
           P   +  +N  PL+  NSA  ++
Sbjct: 91  PLMFILFINDLPLEVSNSALEIY 113


>SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11)
          Length = 520

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 2/65 (3%)
 Frame = -3

Query: 210 GKSISVRLSTFGE*TRRLIGTGDIPLLEPVTRSV--SASISPRTSLKSVNFFPLQCKNSA 37
           GKS++   S   +  +++  +G +   +P+T  V   + + P   +  +N  PL+  NSA
Sbjct: 356 GKSLNWFKSYLEDRKQKVTISGQLSDSQPITVGVPQGSILGPLMFILFINDLPLEVSNSA 415

Query: 36  YSVFP 22
             ++P
Sbjct: 416 LEIYP 420


>SB_48403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 347

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = -3

Query: 108 SASISPRTSLKSVNFFPLQCKNSAYSVFPFISCLVP 1
           SAS SP T  +S+  +     +S Y  F F+ C +P
Sbjct: 231 SASDSPNTQPQSIRRYKKSLISSFYVYFAFVICYLP 266


>SB_18285| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1094

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +1

Query: 4   HEAAYKWKYRICRILTLQGKE 66
           HEAA K KY IC++L   G +
Sbjct: 492 HEAAAKGKYEICQLLLKHGAD 512


>SB_17406| Best HMM Match : DUF433 (HMM E-Value=4.2)
          Length = 220

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = -1

Query: 419 SNFVITPIVRNPCGSTSLASFRASLLAKSVLAGVTARI 306
           SN++IT  +R  CGS SL   R  L+A +V+A   AR+
Sbjct: 185 SNYIITNELRTLCGSLSLRCGR--LMALAVVALHVARL 220


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,560,041
Number of Sequences: 59808
Number of extensions: 389942
Number of successful extensions: 889
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 827
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 889
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1596754500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -