SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0)                      103   9e-23
SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23)          31   0.77 
SB_1163| Best HMM Match : DMA (HMM E-Value=1.4e-11)                    30   1.0  
SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08)               30   1.4  
SB_1824| Best HMM Match : Cupin_3 (HMM E-Value=1.6)                    29   1.8  
SB_55854| Best HMM Match : NinE (HMM E-Value=2.1)                      29   1.8  
SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07)                 28   4.1  
SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.1  
SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3)               28   4.1  
SB_10986| Best HMM Match : WD40 (HMM E-Value=0.026)                    28   4.1  
SB_24597| Best HMM Match : RNA_pol_delta (HMM E-Value=0.71)            28   5.4  
SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)             27   7.2  
SB_1208| Best HMM Match : GRAM (HMM E-Value=0.0034)                    27   7.2  
SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   7.2  
SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37)          27   9.5  

>SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0)
          Length = 768

 Score =  103 bits (247), Expect = 9e-23
 Identities = 46/60 (76%), Positives = 51/60 (85%)
 Frame = +3

Query: 75  QFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVN 254
           +FR  G   LSTY+K YKVGDIVD++ NGAVQKGMPHKVYHGKTGRVYNVT  ALGV+VN
Sbjct: 440 KFRHRGVEHLSTYLKCYKVGDIVDVKANGAVQKGMPHKVYHGKTGRVYNVTKRALGVVVN 499



 Score = 29.1 bits (62), Expect = 2.4
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +1

Query: 25  MTNSKGYXXGTRDLFARSSAH 87
           MTN+KGY  GTR +F++   H
Sbjct: 423 MTNTKGYRRGTRYMFSKKFRH 443


>SB_31082| Best HMM Match : Motilin_ghrelin (HMM E-Value=0.23)
          Length = 565

 Score = 30.7 bits (66), Expect = 0.77
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 335 FLKRVKENERLLKEAKAAGKTVNLKRQPA-PPKAAHIVSGTEKPVLLAPIP 484
           F+KR +  +R L+E   A   +NL ++PA P K    +   EKPV   P P
Sbjct: 272 FVKRTQRRQRELEEVADA---INLAKRPAQPEKPLKFLVKVEKPVPRPPTP 319


>SB_1163| Best HMM Match : DMA (HMM E-Value=1.4e-11)
          Length = 403

 Score = 30.3 bits (65), Expect = 1.0
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = +2

Query: 221 RDCSCSRCDCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERL 367
           RDC+CS+C      R R+   R+ I  +  K ++ R+ + +R  EN RL
Sbjct: 44  RDCTCSKCQLITE-RQRVTAARVAILRQQRKSAELREKY-QREMENVRL 90


>SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08)
          Length = 654

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 2/67 (2%)
 Frame = -2

Query: 385 SLGFLQ*PLILFDSLKEVLSALGVLDMLNTDIDAL--RYNPSANTLLTITPRA*AVTLYT 212
           S+ F +   I  D+LK  L +  +     TD++ +  +YN + +TLL    +    T+  
Sbjct: 227 SVSFRKIKSINIDTLKNDLRSSELHHSPKTDLNGIVKKYNQTLSTLLDSHAQVKIKTITN 286

Query: 211 RPVFPWY 191
           RP  PW+
Sbjct: 287 RPRLPWF 293


>SB_1824| Best HMM Match : Cupin_3 (HMM E-Value=1.6)
          Length = 305

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 10/31 (32%), Positives = 19/31 (61%)
 Frame = +2

Query: 398 VNLKRQPAPPKAAHIVSGTEKPVLLAPIPYE 490
           VN  +   PP A + ++  ++PVL  P+P++
Sbjct: 130 VNKSKAETPPPAYYTITSNQEPVLNMPVPWQ 160


>SB_55854| Best HMM Match : NinE (HMM E-Value=2.1)
          Length = 271

 Score = 29.5 bits (63), Expect = 1.8
 Identities = 13/40 (32%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
 Frame = +2

Query: 281 KRINIRVEH-VKHSKCRQDFLKRVKENERLLKEAKAAGKT 397
           +RI   ++H ++  K +QDF+  +KE  RL +E+++   T
Sbjct: 39  ERIQSCIDHKLEERKIKQDFVTLIKERNRLGRESRSGAST 78


>SB_52319| Best HMM Match : Rho_N (HMM E-Value=1.8e-07)
          Length = 1458

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 18/60 (30%), Positives = 29/60 (48%)
 Frame = +2

Query: 281 KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 460
           K I +  EH + S C Q F +    N  + ++  + GKT  + +     K  HI+S +EK
Sbjct: 413 KNIELLTEHWECSGCEQRFNRHDNYNRHVTEKRCSGGKTQLICK---GEKFKHIMSSSEK 469


>SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4529

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 15/71 (21%), Positives = 35/71 (49%)
 Frame = +2

Query: 281  KRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEK 460
            +++ +        K R + ++   + +RLL+++++  K   L++ P P  A  + +  E 
Sbjct: 1536 RKLTVEQREPYRLKARDNRVRLKDQEKRLLRQSESEKKHAALEQPPTP--APQVETQPET 1593

Query: 461  PVLLAPIPYEF 493
            P+  A  P+ F
Sbjct: 1594 PIHQAASPFVF 1604


>SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3)
          Length = 218

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 3/98 (3%)
 Frame = +2

Query: 92  NYSALHVHESVQSWRHCRHQRQWCSSKGYATQSIP--WKDRS-RVQRDCSCSRCDCQQRV 262
           N  A+ + ESV+SWR     R++   +  + +  P    DRS +V       RCD Q   
Sbjct: 85  NPDAMLLRESVRSWRE-NIPRKYSDLRPTSLKISPSCVPDRSEKVGISFMSGRCDMQYHG 143

Query: 263 RGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKE 376
             R +P+ +   V  +  S+ R+  +  V    R L+E
Sbjct: 144 ISRPVPESV-FEVTRIHQSRRRKRRVNHVTRAWRRLRE 180


>SB_10986| Best HMM Match : WD40 (HMM E-Value=0.026)
          Length = 528

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = +2

Query: 197 WKDRSRVQRDCSCSRCDCQQRVRG--RIIPKRINIRVEHVKHSKCRQDFLKRVKENERLL 370
           WK++  ++ +     C  Q+  +   + +P + + ++  ++ SKC Q+ L   KEN RL+
Sbjct: 342 WKEQYIIRANWFSGHCHVQKLHQNEHKTLPHQ-SAKITCLRISKCSQNLLASAKENSRLV 400


>SB_24597| Best HMM Match : RNA_pol_delta (HMM E-Value=0.71)
          Length = 1139

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = +2

Query: 161 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQ 256
           C+S    +      D+S VQ+DCS  R DC +
Sbjct: 736 CNSSDIGSTPTILSDKSPVQQDCSSIRRDCSR 767


>SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)
          Length = 6725

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = +2

Query: 137  HC-RHQRQWCSSKGYATQSIPW--KDRSRVQRDCSCSRCDCQQRVRGRIIPKRINI 295
            HC RH ++   +   AT+ +PW  KD S   R C  + C C       +   R++I
Sbjct: 1275 HCQRHYQEKTRNWFLATRHVPWCRKDGSYDPRQCYKTDCFCVNEYGVYMSASRVDI 1330


>SB_1208| Best HMM Match : GRAM (HMM E-Value=0.0034)
          Length = 1021

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 15/53 (28%), Positives = 25/53 (47%)
 Frame = +2

Query: 164 SSKGYATQSIPWKDRSRVQRDCSCSRCDCQQRVRGRIIPKRINIRVEHVKHSK 322
           S K     S  WK+  +++++  C     QQRV    I +R+ +   H K S+
Sbjct: 380 SEKSQKVHSANWKEEIQLRKELDCLNKQEQQRVSRISIEQRLAVDRFHRKLSR 432


>SB_18296| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 865

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +3

Query: 303 SMSSTPSADKTSLRESKRMRGY*RKPRLPARPST*RDSQLPLKLP 437
           ++S+ PS  KT+   ++R     RKP +PAR ST       ++ P
Sbjct: 633 TLSAPPSRPKTAPTSAQRTPEPIRKPLVPARMSTDSTDAFKIQAP 677


>SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37)
          Length = 646

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 16/69 (23%), Positives = 30/69 (43%)
 Frame = +2

Query: 158 WCSSKGYATQSIPWKDRSRVQRDCSCSRCDCQQRVRGRIIPKRINIRVEHVKHSKCRQDF 337
           WC ++ Y  ++     + R+ +D S  + +  QRV    +P   N+R+      +  QD 
Sbjct: 106 WCGARTYNKRASTLSTQPRLYQDSSKEQTEQHQRVGAEPVP-TTNVRLTLSTQPRLYQDP 164

Query: 338 LKRVKENER 364
            K   E  +
Sbjct: 165 SKEQTEQHQ 173


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,954,491
Number of Sequences: 59808
Number of extensions: 356162
Number of successful extensions: 1107
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1039
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1104
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1191330434
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -