SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20058
         (614 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_28012| Best HMM Match : RNA_pol_Rpa43 (HMM E-Value=7.1e-08)         63   2e-10
SB_12953| Best HMM Match : Defensin_2 (HMM E-Value=3.6)                29   3.0  
SB_11460| Best HMM Match : Pkinase (HMM E-Value=0)                     28   5.2  
SB_42868| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.1  

>SB_28012| Best HMM Match : RNA_pol_Rpa43 (HMM E-Value=7.1e-08)
          Length = 242

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 31/80 (38%), Positives = 44/80 (55%)
 Frame = +3

Query: 255 KELNGVLVSYKNPCILQNVGTIRNDNADIHFQVQADYFIFQPYIGAKLTGLVNKKCSTHL 434
           ++L  V+V+Y    +LQ  G I +++  +HF  Q DY  F+P IG KL G+VNK    H+
Sbjct: 61  EKLRAVIVAYDKVTLLQRRGNIIDESPFLHFDAQVDYITFKPEIGNKLIGVVNKFGYDHI 120

Query: 435 SVLVHRVFNVVIPQPTEEPG 494
             LVH  FN  I +     G
Sbjct: 121 GCLVHGCFNASIAKSRTSNG 140


>SB_12953| Best HMM Match : Defensin_2 (HMM E-Value=3.6)
          Length = 433

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 2/76 (2%)
 Frame = -1

Query: 389 TYVWLKYEVIRLNLEMYIRIIIAYSANILKYTRIFIAY*DTVQLFSNLPTL*SN-KFVID 213
           T+V + Y  + +   +Y  +II Y+  I+ YT + I+Y   + L     T   N +  + 
Sbjct: 25  THVIILYTHVNI---LYTHVIIPYTRVIIHYTHVIISYTHMIILIRTARTDDQNRRHYVP 81

Query: 212 SLIFP-RHHGCKARFC 168
           +++ P  H  C   FC
Sbjct: 82  AMLPPFIHRKCYPLFC 97


>SB_11460| Best HMM Match : Pkinase (HMM E-Value=0)
          Length = 323

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = -1

Query: 389 TYVWLKYEVIRLNLEMYIRIIIAYSANILKYTR 291
           TYV    EVI  N  MYI   +A + ++L+Y R
Sbjct: 110 TYVTTLLEVIETNTRMYIITDLAENGDLLEYIR 142


>SB_42868| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1353

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 19/61 (31%), Positives = 33/61 (54%)
 Frame = -1

Query: 383 VWLKYEVIRLNLEMYIRIIIAYSANILKYTRIFIAY*DTVQLFSNLPTL*SNKFVIDSLI 204
           V L+ E+I+ N + Y+ +  AYS  I+K+T     +  TV    +L T+ +NK  +   +
Sbjct: 49  VTLRCELIQ-NTKSYLNVHCAYSGEIVKFTEPMSLFDTTV---GDLKTMVTNKTGLHVSV 104

Query: 203 F 201
           F
Sbjct: 105 F 105


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,021,883
Number of Sequences: 59808
Number of extensions: 326928
Number of successful extensions: 618
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 585
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 617
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1512078125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -