SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_49487| Best HMM Match : Zip (HMM E-Value=0.014)                     30   1.2  
SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.)                30   1.5  
SB_20662| Best HMM Match : bZIP_1 (HMM E-Value=0.89)                   29   2.7  
SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.7  
SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.6  
SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.7  
SB_58880| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.7  
SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.2  
SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45)               27   8.2  
SB_39387| Best HMM Match : Lipase_GDSL (HMM E-Value=0.038)             27   8.2  
SB_2140| Best HMM Match : DUF1154 (HMM E-Value=1)                      27   8.2  
SB_1285| Best HMM Match : SET (HMM E-Value=0.011)                      27   8.2  
SB_15895| Best HMM Match : Hint (HMM E-Value=1.4013e-45)               27   8.2  
SB_9370| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   8.2  
SB_1291| Best HMM Match : SWIRM (HMM E-Value=5e-23)                    27   8.2  

>SB_49487| Best HMM Match : Zip (HMM E-Value=0.014)
          Length = 510

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 16/74 (21%), Positives = 31/74 (41%)
 Frame = +3

Query: 255 KSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
           ++D    +V   ++ I+     LR+     H ++   +  HH   +KI S          
Sbjct: 42  RTDGSGSDVSSGSDSIENEKFTLRDDHTDNHHQNHHDHHHHHHHDKKIDSKTSIATVAWM 101

Query: 435 IALRQGFQEVSDGI 476
           + +  GF  +SDG+
Sbjct: 102 VIVSDGFHNLSDGL 115


>SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 652

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +3

Query: 330 PGPPQHQEHETQNPEHHEDAEKIVSSVKN---DINTAEIALRQGFQEVSDGIG 479
           P PP H + E     H E  E+I S  K+   D+  A+  L++  +++ + +G
Sbjct: 282 PNPPPHLDEEKIKQLHEELKEEIKSMAKDSEKDLEDAKKDLKEEIEQIKEEVG 334


>SB_20662| Best HMM Match : bZIP_1 (HMM E-Value=0.89)
          Length = 589

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 14/63 (22%), Positives = 28/63 (44%)
 Frame = +3

Query: 249 VVKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINT 428
           V +S+ +    P +   ++R       P P  H+  ++ +     D+E+  SSV ND   
Sbjct: 427 VQRSNSQRSSSPTKEVTVQRSSSQRGPPSPSAHKSLQSSHQVQRSDSERAFSSVLNDPQA 486

Query: 429 AEI 437
            ++
Sbjct: 487 GDV 489


>SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3760

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 14/63 (22%), Positives = 28/63 (44%)
 Frame = +3

Query: 249  VVKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINT 428
            V +S+ +    P +   ++R       P P  H+  ++ +     D+E+  SSV ND   
Sbjct: 3533 VQRSNSQRSSSPTKEVTVQRSSSQRGPPSPSAHKSLQSSHQVQRSDSERAFSSVLNDPQA 3592

Query: 429  AEI 437
             ++
Sbjct: 3593 GDV 3595


>SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1293

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 5/79 (6%)
 Frame = +3

Query: 252 VKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHH-----EDAEKIVSSVKN 416
           V SD E+ EV        RPL++  N    +H+ +   NP  +     ++  K V+ +K 
Sbjct: 695 VHSDTESEEVDVVTVSYDRPLLNRTNSSSSEHEVYVPNNPHKNNNRIKKNQTKTVNGLKE 754

Query: 417 DINTAEIALRQGFQEVSDG 473
            +N     +     E+S G
Sbjct: 755 HVNGKLSPIVSPKDEISTG 773


>SB_21701| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1906

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 5/64 (7%)
 Frame = +3

Query: 273  VEVPDENEEIKRPLVDLRNPGPPQHQEHETQN---PEHHEDAEKI--VSSVKNDINTAEI 437
            +  PDE E +   + DL NP   +  E E Q+     + +D EKI  V S     N + I
Sbjct: 828  INSPDEREIVLSEIYDLDNPSDDEELETEIQDALETANEQDKEKILAVYSALRSPNLSGI 887

Query: 438  ALRQ 449
             L Q
Sbjct: 888  ELAQ 891


>SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1554

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 26/103 (25%), Positives = 41/103 (39%), Gaps = 8/103 (7%)
 Frame = +3

Query: 276 EVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIAL---- 443
           EVPD+   +   +  + +  PP+H+     N  HH    K  S+ +  I  AE  L    
Sbjct: 47  EVPDQ-VWLADDVSSVSSYSPPKHKHSSKSNGHHHNSRHKSESAKEPPILKAERKLLAST 105

Query: 444 ----RQGFQEVSDGIGKWYARTEQIKSSRPACNISKKISALRY 560
                  +  VSD I +    T+     R +  IS++  A  Y
Sbjct: 106 SPTRSANYPYVSDRIPRKSTYTQDFADGRKSKAISRRDEAYGY 148


>SB_58880| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1098

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 5/100 (5%)
 Frame = +3

Query: 240 NQTVVKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQ--EHETQNPEHHEDAEKIVSSVK 413
           N+T  K D+   E+   N + K     LR          + +TQ     +  EK +  +K
Sbjct: 271 NETKSKMDVAKSELEIYNSQHKNAQTQLREAHANLESVIQKQTQRKSEIKSIEKELPDLK 330

Query: 414 NDINTAEIALR---QGFQEVSDGIGKWYARTEQIKSSRPA 524
           N++  AE  L    QG  + S  +    ++ E+ +SS  A
Sbjct: 331 NNLKKAEADLEKAVQGEAKSSQELRSIRSKVEEARSSLQA 370


>SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 421

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 3/44 (6%)
 Frame = +3

Query: 264 LENVEVPDENEEIKRP---LVDLRNPGPPQHQEHETQNPEHHED 386
           L N  +PDE+ E  RP   L DL +  PP     E  +  +HED
Sbjct: 184 LVNTRMPDESPEPTRPPPPLDDLDDLPPPPPPPPEDDSIHNHED 227


>SB_42335| Best HMM Match : Hint (HMM E-Value=1.4013e-45)
          Length = 825

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = -1

Query: 468 LTLPGSLDEERFPLC*CHF*RKKRFFQHLR 379
           +T+P    EE+ P+C  H   +K+F +HLR
Sbjct: 539 VTVPARECEEKEPICIRHKLERKKFNKHLR 568


>SB_39387| Best HMM Match : Lipase_GDSL (HMM E-Value=0.038)
          Length = 155

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = -1

Query: 468 LTLPGSLDEERFPLC*CHF*RKKRFFQHLR 379
           +T+P    EE+ P+C  H   +K+F +HLR
Sbjct: 65  VTVPARECEEKEPICIRHKLERKKFNKHLR 94


>SB_2140| Best HMM Match : DUF1154 (HMM E-Value=1)
          Length = 155

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 15/64 (23%), Positives = 28/64 (43%)
 Frame = +3

Query: 318 DLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYART 497
           ++R      H+  E  + EHHE    I    +++IN  + +  +     S+   KW  R 
Sbjct: 13  NIRKTAENHHRHIEKIHEEHHEHIGSIEQDHEDEINKMKESFDRRETVASEMDYKWQRRE 72

Query: 498 EQIK 509
            ++K
Sbjct: 73  NELK 76


>SB_1285| Best HMM Match : SET (HMM E-Value=0.011)
          Length = 829

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
 Frame = +3

Query: 279 VPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAE-KIVSSVKNDI 422
           V +  EE+ R LV L   GPP   +  T+ P   E     ++S VK ++
Sbjct: 558 VAEFREELVRQLVGLEEFGPPPAHKPPTRAPNQFETVHMPMMSDVKRNL 606


>SB_15895| Best HMM Match : Hint (HMM E-Value=1.4013e-45)
          Length = 561

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = -1

Query: 468 LTLPGSLDEERFPLC*CHF*RKKRFFQHLR 379
           +T+P    EE+ P+C  H   +K+F +HLR
Sbjct: 275 VTVPARECEEKEPICIRHKLERKKFNKHLR 304


>SB_9370| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 310

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 13/48 (27%), Positives = 23/48 (47%)
 Frame = +3

Query: 246 TVVKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDA 389
           T+   +L + ++P E  E +   V+ + P P +  E E   P+  E A
Sbjct: 101 TLTDDELSDDDIPKEIMEAEEQQVENKFPEPEEEDEEEDDTPQGLEGA 148


>SB_1291| Best HMM Match : SWIRM (HMM E-Value=5e-23)
          Length = 158

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 13/48 (27%), Positives = 23/48 (47%)
 Frame = +3

Query: 246 TVVKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDA 389
           T+   +L + ++P E  E +   V+ + P P +  E E   P+  E A
Sbjct: 12  TLTDDELSDDDIPKEIMEAEEQQVENKFPEPEEEDEEEDDTPQGLEGA 59


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,924,069
Number of Sequences: 59808
Number of extensions: 270422
Number of successful extensions: 1036
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 968
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1034
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1361520496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -