SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20056
         (750 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)                      210   7e-55
SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)             130   2e-30
SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)                       124   6e-29
SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36)                107   9e-24
SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)                      101   6e-22
SB_57217| Best HMM Match : Helicase_C (HMM E-Value=0.049)              58   1e-08
SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07)                 42   7e-04
SB_51671| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.76 
SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)                 31   1.00 
SB_55989| Best HMM Match : zf-C2H2 (HMM E-Value=8e-08)                 30   2.3  
SB_7343| Best HMM Match : EGF (HMM E-Value=0)                          30   2.3  
SB_24762| Best HMM Match : Astacin (HMM E-Value=0)                     29   3.0  
SB_7560| Best HMM Match : Metallothio_PEC (HMM E-Value=1.3)            29   3.0  
SB_44696| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.0  
SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.0  
SB_9053| Best HMM Match : TIG (HMM E-Value=0)                          29   5.3  
SB_54008| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.0  
SB_42630| Best HMM Match : Ets (HMM E-Value=0)                         28   9.3  
SB_47707| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.3  
SB_45916| Best HMM Match : Cadherin (HMM E-Value=0)                    28   9.3  
SB_34715| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.3  

>SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1097

 Score =  210 bits (514), Expect = 7e-55
 Identities = 122/228 (53%), Positives = 141/228 (61%), Gaps = 2/228 (0%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           MAK PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF+DTERLIGDAAKNQVA
Sbjct: 1   MAKTPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVA 60

Query: 252 MTP-TTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQ 428
           M P  T +    +        ++ +          +   +   Q    G +++ FP    
Sbjct: 61  MNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEIS 120

Query: 429 FHGAYENEGNCRSLSWQNCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                + +    +       +      AYF+DSQRQATKDAGTI+GLNVLRIINEPTAAA
Sbjct: 121 SMVLTKMKETAEAYLGAKVTDAVVTVPAYFHDSQRQATKDAGTIAGLNVLRIINEPTAAA 180

Query: 609 IAYGLDKKGTGERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           IAYGLDKK   ERNVLI+DLGGGT     L         +   GDTHL
Sbjct: 181 IAYGLDKKVGVERNVLIYDLGGGTFDVSVLTIEDGIFEVKSTAGDTHL 228



 Score = 87.0 bits (206), Expect = 1e-17
 Identities = 39/56 (69%), Positives = 48/56 (85%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F V+ +G +PKI+V +KGE K+FFPEE+SSMVLTKMKETAEAYLG  V +AV+TVP
Sbjct: 92  FHVIREGERPKIQVEFKGEKKSFFPEEISSMVLTKMKETAEAYLGAKVTDAVVTVP 147



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 22/33 (66%), Positives = 26/33 (78%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF+D  V  DM HWPF +
Sbjct: 62  NPENTVFDAKRLIGRKFDDPVVARDMTHWPFHV 94


>SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 746

 Score =  130 bits (313), Expect = 2e-30
 Identities = 59/64 (92%), Positives = 61/64 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M KAPA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD ERL+GDAAKNQVA
Sbjct: 1   MTKAPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVA 60

Query: 252 MTPT 263
           M PT
Sbjct: 61  MNPT 64



 Score =  109 bits (262), Expect = 2e-24
 Identities = 59/81 (72%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGT   
Sbjct: 241 AYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTFDV 300

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L         +   GDTHL
Sbjct: 301 SVLSIEDGIFEVKSTHGDTHL 321



 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 40/57 (70%), Positives = 47/57 (82%)
 Frame = +1

Query: 340 AFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           A  VV++ G+PK+KV YKGE KTFF EE+SSMVL KMKETAEAYLG  V +AV+TVP
Sbjct: 116 AEEVVNEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVP 172



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 26/53 (49%), Positives = 35/53 (66%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPF 412
           +P NTIFDAKRLIGR+F+D  V+ DMKHW FE+       + +   + +TK F
Sbjct: 62  NPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTF 114



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/30 (73%), Positives = 26/30 (86%)
 Frame = +1

Query: 421 EVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           ++SSMVL KMKETAEAYLG  V +AV+TVP
Sbjct: 211 QISSMVLNKMKETAEAYLGCKVTDAVVTVP 240



 Score = 35.5 bits (78), Expect = 0.046
 Identities = 15/15 (100%), Positives = 15/15 (100%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAG 554
           AYFNDSQRQATKDAG
Sbjct: 173 AYFNDSQRQATKDAG 187


>SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 640

 Score =  124 bits (300), Expect = 6e-29
 Identities = 56/63 (88%), Positives = 60/63 (95%)
 Frame = +3

Query: 72  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           M KAPA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYV FTDTERL+GDAAKNQVA
Sbjct: 1   MGKAPAIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVA 60

Query: 252 MTP 260
           + P
Sbjct: 61  LNP 63



 Score =  109 bits (262), Expect = 2e-24
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT--S 683
           AYFNDSQRQATKDAGTI+GLNVLR+INEPTAAA+AYGLDK  +GE+NVLIFDLGGGT   
Sbjct: 148 AYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTFDV 207

Query: 684 TCPSLPSRRYLRGEIHRGDTHL 749
           +  ++        +   GDTHL
Sbjct: 208 SILTIDDGSLFEVKSTAGDTHL 229



 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 40/56 (71%), Positives = 47/56 (83%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+++SD  KPKI+V YKGE KTF  EE+SSMVL KMKETAEAYLG+ V +AVITVP
Sbjct: 92  FKIISDNNKPKIQVEYKGERKTFAAEEISSMVLGKMKETAEAYLGQKVTSAVITVP 147



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 24/33 (72%), Positives = 31/33 (93%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTIFDAKRLIGR+++DATVQ+DMK WPF++
Sbjct: 62  NPENTIFDAKRLIGRRYDDATVQSDMKLWPFKI 94


>SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36)
          Length = 437

 Score =  107 bits (257), Expect = 9e-24
 Identities = 76/212 (35%), Positives = 113/212 (53%), Gaps = 11/212 (5%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 251
           K   +GIDLGTTYSCVG +Q   G+++I +++  ++  PS VAFTD   L+G+ A +Q  
Sbjct: 30  KPKIIGIDLGTTYSCVGAYQAISGRIDIFSDENDDKVVPSLVAFTDKGVLVGEKALSQAE 89

Query: 252 MTP-TTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQ----GSI*G*RQNLFP 416
           + P  T Y          +K  L +      +     +R T D+    G + G + N   
Sbjct: 90  INPKNTIYDAKRFIGKTFTKQELLE------IGKLYQFRVTTDKRGNAGFLVGKKGNFTV 143

Query: 417 RGSQFHGAYENEGNCRSLSWQNCA----ECSYHGSAYFNDSQRQATKDAGTISGLNVLRI 584
              +  G Y  +   R+++ +N      +      A F+  QR AT  A +++G+ VLR+
Sbjct: 144 ITPEEIGGYVIK-KLRTMAERNLTTTVTKAVMSVPAEFDIKQRNATVKAASLAGITVLRV 202

Query: 585 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           INEPTAAA+AYGL KK  G  NV++ DLGGGT
Sbjct: 203 INEPTAAALAYGLHKK-EGVANVMVVDLGGGT 233



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = +1

Query: 343 FRVVSDG-GKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTS 519
           FRV +D  G     V  KG      PEE+   V+ K++  AE  L  TV  AV++VP   
Sbjct: 121 FRVTTDKRGNAGFLVGKKGNFTVITPEEIGGYVIKKLRTMAERNLTTTVTKAVMSVP-AE 179

Query: 520 MTLKDKPQKMQVPSLA 567
             +K +   ++  SLA
Sbjct: 180 FDIKQRNATVKAASLA 195



 Score = 29.5 bits (63), Expect = 3.0
 Identities = 11/17 (64%), Positives = 14/17 (82%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKF 304
           +P NTI+DAKR IG+ F
Sbjct: 91  NPKNTIYDAKRFIGKTF 107


>SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1327

 Score =  101 bits (242), Expect = 6e-22
 Identities = 52/81 (64%), Positives = 59/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510  AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
            AYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYG+DKK  GE+N+L+FDLGGGT   
Sbjct: 846  AYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKK-EGEKNILVFDLGGGTFDV 904

Query: 690  PSLP-SRRYLRGEIHRGDTHL 749
              L             GDTHL
Sbjct: 905  SLLTIDNGVFEVVATNGDTHL 925



 Score = 97.5 bits (232), Expect = 1e-20
 Identities = 45/58 (77%), Positives = 51/58 (87%), Gaps = 1/58 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT+  ERLIGD AKNQ+   P
Sbjct: 704 IGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNP 761



 Score = 74.5 bits (175), Expect = 8e-14
 Identities = 36/56 (64%), Positives = 43/56 (76%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VV    KP ++V  K E KTF  EE+S+MVLTKMKETAEAYLGK V +AV+TVP
Sbjct: 790 FKVVDKNKKPHVQVKVKDEIKTFAAEEISAMVLTKMKETAEAYLGKKVTHAVVTVP 845



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 25/51 (49%), Positives = 38/51 (74%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTK 406
           +P NT+FDAKRLIGR ++D +VQ D+K +PF+  V++ N +   H++VK K
Sbjct: 760 NPENTVFDAKRLIGRSWDDTSVQNDLKFFPFK--VVDKNKKP--HVQVKVK 806


>SB_57217| Best HMM Match : Helicase_C (HMM E-Value=0.049)
          Length = 179

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 40/73 (54%), Positives = 44/73 (60%), Gaps = 26/73 (35%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLN------------------------VLRIINEPTAAAIAY 617
           A+FND+QRQATKDAGTI+GL+                        VLRIINEPTAAAIAY
Sbjct: 47  AHFNDAQRQATKDAGTIAGLDVLSRTASERPPSRFRRRRPHGRSRVLRIINEPTAAAIAY 106

Query: 618 GLDKK--GTGERN 650
           GLDK   G  ERN
Sbjct: 107 GLDKARGGKAERN 119



 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 23/45 (51%), Positives = 34/45 (75%)
 Frame = +1

Query: 376 IKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           I V   GE ++F PE++S++VL ++K  AEA+LG+ V+ AVITVP
Sbjct: 2   IAVEVCGEKRSFAPEQISAVVLEQLKADAEAFLGQAVKRAVITVP 46


>SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1068

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 3/64 (4%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG---TGERNVLI 659
           +C     +Y+ D QR+   DA   +GLN LR++N+ TA ++AYG+ K+       RNV+ 
Sbjct: 198 DCVISVPSYYTDRQRRCMLDASATAGLNCLRLMNDTTAVSLAYGIYKQDLPTDKPRNVVF 257

Query: 660 FDLG 671
            D+G
Sbjct: 258 VDIG 261



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 22/52 (42%), Positives = 33/52 (63%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 245
           VG D+G     + V + G +E +AN+  +R TPS+V+  D +RLIG + KNQ
Sbjct: 4   VGFDVGNQSCYIAVARGGGIETVANEFSDRCTPSFVSLGDKQRLIGTSGKNQ 55



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 20/45 (44%), Positives = 30/45 (66%)
 Frame = +1

Query: 376 IKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           I+V Y G+ + F PE+V +M+ T++K TAE  L   V + VI+VP
Sbjct: 160 IQVQYLGKQEVFSPEQVMAMLFTRLKTTAEIALKTKVTDCVISVP 204



 Score = 36.3 bits (80), Expect = 0.027
 Identities = 15/30 (50%), Positives = 20/30 (66%)
 Frame = +2

Query: 263 NTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           NTI   KR IGRKF D  VQ ++ H P+++
Sbjct: 121 NTISQFKRFIGRKFSDPAVQKEIPHLPYKV 150


>SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1019

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 22/61 (36%), Positives = 39/61 (63%), Gaps = 4/61 (6%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK----GTGERNVLIFDLGGGT 680
           +FN ++R+A   A  + GLNVL+I+N  TA A+ YGL ++     T E++ + +D+G  +
Sbjct: 115 FFNQAERRALLRAAELVGLNVLQIMNSNTAVALNYGLFQQKSFNDTLEKHFMFYDMGASS 174

Query: 681 S 683
           +
Sbjct: 175 T 175



 Score = 34.3 bits (75), Expect = 0.11
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +1

Query: 370 PKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           P +K  Y+  D TF PEE+  M+L   +   E +    +++ V+TVP
Sbjct: 68  PHVK-NYQQSDVTFTPEELMGMILNHSRFIGEQFADHPIKDVVLTVP 113


>SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07)
          Length = 592

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 18/28 (64%), Positives = 22/28 (78%)
 Frame = +3

Query: 141 GKVEIIANDQGNRTTPSYVAFTDTERLI 224
           G   IIAND G+R TP+ VAF+DTE+LI
Sbjct: 83  GNTTIIANDAGDRVTPAMVAFSDTEKLI 110


>SB_51671| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 665

 Score = 31.5 bits (68), Expect = 0.76
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 1/75 (1%)
 Frame = +2

Query: 59  LKIQNGKSTRSRN-RSGYHVLLRWCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCR 235
           L++ N +  ++ + R GY  L R C   R   +  +R  +  H++L      R   +RC 
Sbjct: 225 LRLVNTRDDKTHDKRPGYRKLSRVC-GGRRPNEPYERTARV-HTILSTETETRFCAKRCA 282

Query: 236 QEPGGDDPNNTIFDA 280
               G DP NT F+A
Sbjct: 283 GTASGMDPKNTPFNA 297


>SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)
          Length = 212

 Score = 31.1 bits (67), Expect = 1.00
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +3

Query: 150 EIIANDQGNRTTPSYVAFT-DTERL 221
           ++I N +G+RTTPS VAFT + ERL
Sbjct: 7   KVIENAEGSRTTPSVVAFTPEGERL 31


>SB_55989| Best HMM Match : zf-C2H2 (HMM E-Value=8e-08)
          Length = 1011

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 17/62 (27%), Positives = 28/62 (45%)
 Frame = +1

Query: 367 KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSMTLKDKPQK 546
           +PK K   + E+     EE  +M   ++K      LGK V+  + T    ++TL  + Q 
Sbjct: 654 QPKFKKTKEEEEFDKLLEEADAMTQQEVKNVKNIKLGKNVKTQLYTCEPCNITLNSQKQM 713

Query: 547 MQ 552
            Q
Sbjct: 714 SQ 715


>SB_7343| Best HMM Match : EGF (HMM E-Value=0)
          Length = 1233

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 18/72 (25%), Positives = 30/72 (41%)
 Frame = +3

Query: 111 TYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQYSMPNVS 290
           T++   +  H    I+ N  G  +TP     + T       A + + MTPT       V+
Sbjct: 559 THTTTSITLHPSSAILDNSLGPASTPRTTISSTTHVSSTPIASSSMVMTPTAINPSATVT 618

Query: 291 SDVSSKMLLCKP 326
           + V S  ++ KP
Sbjct: 619 TTVPSTSVVVKP 630


>SB_24762| Best HMM Match : Astacin (HMM E-Value=0)
          Length = 733

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 11/29 (37%), Positives = 19/29 (65%)
 Frame = -1

Query: 552 LHLLWLVFESH*STRNRDNCILHSFAKIS 466
           ++ LWL F  + S+ + D C+LHS A ++
Sbjct: 415 IYTLWLDFSRYYSSASSDICVLHSIAHLA 443


>SB_7560| Best HMM Match : Metallothio_PEC (HMM E-Value=1.3)
          Length = 350

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 16/33 (48%), Positives = 19/33 (57%)
 Frame = -1

Query: 258 GSSPPGSWRHLR*DARCL*TQHKTEWSCCPGRW 160
           GS PPG W   R +AR   T  +T +SC PG W
Sbjct: 206 GSCPPGFWCRKRREARAA-TDLET-YSCPPGFW 236


>SB_44696| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 695

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 14/42 (33%), Positives = 19/42 (45%)
 Frame = +2

Query: 230 CRQEPGGDDPNNTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           C Q     D N TI   K L+ +  ED      ++HWP + S
Sbjct: 389 CLQICANSDGNLTITPVKTLVFKAAEDTKPSHHLRHWPQQSS 430


>SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1066

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 1/75 (1%)
 Frame = +2

Query: 59  LKIQNGKSTRSRN-RSGYHVLLRWCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCR 235
           L++ N +  ++   R GY  L R C   R   +  +R  +  H++L      R   +RC 
Sbjct: 661 LRLVNTRDDKTHGKRPGYRKLSRVC-GGRRPNEPYERTARV-HTILSTDTETRFCEKRCA 718

Query: 236 QEPGGDDPNNTIFDA 280
               G DP N  F+A
Sbjct: 719 GTASGMDPKNIPFNA 733


>SB_9053| Best HMM Match : TIG (HMM E-Value=0)
          Length = 2990

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +3

Query: 18   HVC*VVLRTSNKTD*KYKMAKAPAVGIDL 104
            HVC +V  T  K   K  ++K PA GI+L
Sbjct: 1200 HVCNIVSNTETKITCKLDVSKTPAPGIEL 1228


>SB_54008| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1940

 Score = 28.3 bits (60), Expect = 7.0
 Identities = 11/19 (57%), Positives = 12/19 (63%)
 Frame = +1

Query: 691  HPYHRGGIFEVKSTAATPT 747
            HPYHRG  F   ST+A  T
Sbjct: 1068 HPYHRGSQFSTVSTSAAST 1086


>SB_42630| Best HMM Match : Ets (HMM E-Value=0)
          Length = 631

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +1

Query: 100 IWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           IW P+   L++S     R+S +     PLR  L    P VSS +P  T
Sbjct: 42  IWPPKKQHLMASYPSTSRASASRSHLFPLRTGLPPVPPLVSSPLPSPT 89


>SB_47707| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 627

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 33/106 (31%), Positives = 41/106 (38%), Gaps = 3/106 (2%)
 Frame = +3

Query: 435 GAYENEG-NCRSLSWQNCAECSYHGSAYFNDSQRQAT--KDAGTISGLNVLRIINEPTAA 605
           GA +N   +  SL W  C +  YHG      +   A     AG  S  NV+R +  P A 
Sbjct: 512 GATQNANESLNSLVWARCPKHKYHGYKVIRCAVAAAVCHFHAGASSRENVMRRLCVP-AG 570

Query: 606 AIAYGLDKKGTGERNVLIFDLGGGTSTCPSLPSRRYLRGEIHRGDT 743
               G   K T          G G +   SLP R   RGE  R D+
Sbjct: 571 HTQEGHPSKRT----------GSGFTNLTSLPQRMPRRGEGSRLDS 606


>SB_45916| Best HMM Match : Cadherin (HMM E-Value=0)
          Length = 1774

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = -2

Query: 659 DKYISFSSTLFVKTVSNRSSSRFIDDSEN 573
           +K ISF  +LF+  VSN S+ R+I  +E+
Sbjct: 752 NKVISFGPSLFMDKVSNASAGRYICIAES 780


>SB_34715| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 977

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +1

Query: 100 IWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           IW P+   L++S     R+S +     PLR  L    P VSS +P  T
Sbjct: 388 IWPPKKQHLMASYPSTSRASASRSHLFPLRTGLPPVPPLVSSPLPSPT 435


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,559,308
Number of Sequences: 59808
Number of extensions: 618716
Number of successful extensions: 1906
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 1656
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1895
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2034222073
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -