SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20055
         (759 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)                      158   4e-39
SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)             157   9e-39
SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)                       155   3e-38
SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)                      142   2e-34
SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36)                 95   6e-20
SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.)              70   2e-12
SB_57217| Best HMM Match : Helicase_C (HMM E-Value=0.049)              62   5e-10
SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   2e-08
SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   6e-06
SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07)                 42   7e-04
SB_51671| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.0  
SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)                 31   1.0  
SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5)                   31   1.3  
SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015)               30   2.3  
SB_55989| Best HMM Match : zf-C2H2 (HMM E-Value=8e-08)                 29   3.1  
SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0)                     29   3.1  
SB_33576| Best HMM Match : Pentaxin (HMM E-Value=1.3e-06)              29   3.1  
SB_56695| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.1  
SB_49831| Best HMM Match : 7tm_1 (HMM E-Value=0)                       29   4.1  
SB_24762| Best HMM Match : Astacin (HMM E-Value=0)                     29   4.1  
SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.1  
SB_12344| Best HMM Match : ATP-synt_B (HMM E-Value=1.9)                29   4.1  
SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.4  
SB_43628| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.4  
SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.4  
SB_9053| Best HMM Match : TIG (HMM E-Value=0)                          29   5.4  
SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.4  
SB_24848| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.4  
SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   7.2  
SB_7301| Best HMM Match : S-antigen (HMM E-Value=2.1)                  28   7.2  
SB_50059| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.5  
SB_42630| Best HMM Match : Ets (HMM E-Value=0)                         28   9.5  
SB_45916| Best HMM Match : Cadherin (HMM E-Value=0)                    28   9.5  
SB_34715| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.5  

>SB_45540| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1097

 Score =  158 bits (384), Expect = 4e-39
 Identities = 76/84 (90%), Positives = 80/84 (95%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYF+DSQRQATKDAGTI+GLNVLRIINEPTAAAIAYGLDKK   ERNVLI+DLGGGTF
Sbjct: 146 VPAYFHDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGVERNVLIYDLGGGTF 205

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTIEDGIFEVKSTAGDTH G
Sbjct: 206 DVSVLTIEDGIFEVKSTAGDTHLG 229



 Score =  136 bits (330), Expect = 1e-32
 Identities = 60/87 (68%), Positives = 72/87 (82%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NT+FDAKRLIGRKF+D  V  DM HWPF V+ +G +PKI+V +KGE K+FFPEE+S
Sbjct: 61  MNPENTVFDAKRLIGRKFDDPVVARDMTHWPFHVIREGERPKIQVEFKGEKKSFFPEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVLTKMKETAEAYLG  V +AV+T P
Sbjct: 121 SMVLTKMKETAEAYLGAKVTDAVVTVP 147



 Score =  126 bits (303), Expect = 3e-29
 Identities = 59/63 (93%), Positives = 60/63 (95%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           MAK PAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF+DTERLIGDAAKNQVA
Sbjct: 1   MAKTPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  MNP 63


>SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 746

 Score =  157 bits (381), Expect = 9e-39
 Identities = 76/84 (90%), Positives = 78/84 (92%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKK   ERNVLIFDLGGGTF
Sbjct: 239 VPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAAIAYGLDKKVGQERNVLIFDLGGGTF 298

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L+IEDGIFEVKST GDTH G
Sbjct: 299 DVSVLSIEDGIFEVKSTHGDTHLG 322



 Score =  126 bits (304), Expect = 2e-29
 Identities = 58/64 (90%), Positives = 60/64 (93%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M KAPA+GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD ERL+GDAAKNQVA
Sbjct: 1   MTKAPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVA 60

Query: 255 *TPT 266
             PT
Sbjct: 61  MNPT 64



 Score =  113 bits (273), Expect = 1e-25
 Identities = 63/112 (56%), Positives = 73/112 (65%), Gaps = 25/112 (22%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEV- 430
           +NP NTIFDAKRLIGR+F+D  V+ DMKHW FEVV++ G+PK+KV YKGE KTFF EEV 
Sbjct: 61  MNPTNTIFDAKRLIGRRFDDPGVKDDMKHWSFEVVNEAGRPKVKVEYKGETKTFFAEEVV 120

Query: 431 ------------------------SSMVLTKMKETAEAYLGKTVQNAVITFP 514
                                   SSMVL KMKETAEAYLG  V +AV+T P
Sbjct: 121 NEAGRPKVKVEYKGETKTFFAEEISSMVLNKMKETAEAYLGCKVTDAVVTVP 172



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 21/30 (70%), Positives = 25/30 (83%)
 Frame = +2

Query: 425 EVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           ++SSMVL KMKETAEAYLG  V +AV+T P
Sbjct: 211 QISSMVLNKMKETAEAYLGCKVTDAVVTVP 240



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAG 558
           VPAYFNDSQRQATKDAG
Sbjct: 171 VPAYFNDSQRQATKDAG 187


>SB_8490| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 640

 Score =  155 bits (377), Expect = 3e-38
 Identities = 74/85 (87%), Positives = 81/85 (95%), Gaps = 1/85 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAGTI+GLNVLR+INEPTAAA+AYGLDK  +GE+NVLIFDLGGGTF
Sbjct: 146 VPAYFNDSQRQATKDAGTIAGLNVLRVINEPTAAALAYGLDKSLSGEKNVLIFDLGGGTF 205

Query: 688 DVSILTIEDG-IFEVKSTAGDTHFG 759
           DVSILTI+DG +FEVKSTAGDTH G
Sbjct: 206 DVSILTIDDGSLFEVKSTAGDTHLG 230



 Score =  138 bits (333), Expect = 6e-33
 Identities = 63/87 (72%), Positives = 75/87 (86%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           +NP NTIFDAKRLIGR+++DATVQ+DMK WPF+++SD  KPKI+V YKGE KTF  EE+S
Sbjct: 61  LNPENTIFDAKRLIGRRYDDATVQSDMKLWPFKIISDNNKPKIQVEYKGERKTFAAEEIS 120

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           SMVL KMKETAEAYLG+ V +AVIT P
Sbjct: 121 SMVLGKMKETAEAYLGQKVTSAVITVP 147



 Score =  122 bits (294), Expect = 3e-28
 Identities = 56/63 (88%), Positives = 59/63 (93%)
 Frame = +3

Query: 75  MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           M KAPA+GIDLGTTYSCVGVFQ+GKVEIIANDQGNRTTPSYV FTDTERL+GDAAKNQVA
Sbjct: 1   MGKAPAIGIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVA 60

Query: 255 *TP 263
             P
Sbjct: 61  LNP 63


>SB_45647| Best HMM Match : HSP70 (HMM E-Value=0)
          Length = 1327

 Score =  142 bits (345), Expect = 2e-34
 Identities = 65/84 (77%), Positives = 77/84 (91%)
 Frame = +1

Query: 508  VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
            VPAYFND+QRQATKDAG I+GL V+RIINEPTAAAIAYG+DKK  GE+N+L+FDLGGGTF
Sbjct: 844  VPAYFNDAQRQATKDAGAIAGLTVMRIINEPTAAAIAYGMDKK-EGEKNILVFDLGGGTF 902

Query: 688  DVSILTIEDGIFEVKSTAGDTHFG 759
            DVS+LTI++G+FEV +T GDTH G
Sbjct: 903  DVSLLTIDNGVFEVVATNGDTHLG 926



 Score =  116 bits (278), Expect = 3e-26
 Identities = 54/86 (62%), Positives = 67/86 (77%)
 Frame = +2

Query: 257  NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
            NP NT+FDAKRLIGR ++D +VQ D+K +PF+VV    KP ++V  K E KTF  EE+S+
Sbjct: 760  NPENTVFDAKRLIGRSWDDTSVQNDLKFFPFKVVDKNKKPHVQVKVKDEIKTFAAEEISA 819

Query: 437  MVLTKMKETAEAYLGKTVQNAVITFP 514
            MVLTKMKETAEAYLGK V +AV+T P
Sbjct: 820  MVLTKMKETAEAYLGKKVTHAVVTVP 845



 Score = 96.3 bits (229), Expect = 2e-20
 Identities = 45/58 (77%), Positives = 51/58 (87%), Gaps = 1/58 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGVF++G+VEIIANDQGNR TPSYVAFT+  ERLIGD AKNQ+   P
Sbjct: 704 IGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNP 761


>SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36)
          Length = 437

 Score = 95.1 bits (226), Expect = 6e-20
 Identities = 46/84 (54%), Positives = 60/84 (71%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPA F+  QR AT  A +++G+ VLR+INEPTAAA+AYGL KK  G  NV++ DLGGGT 
Sbjct: 176 VPAEFDIKQRNATVKAASLAGITVLRVINEPTAAALAYGLHKK-EGVANVMVVDLGGGTL 234

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L I+ G+F   + AG+   G
Sbjct: 235 DVSLLNIQGGMFVTMAMAGNNRLG 258



 Score = 61.3 bits (142), Expect = 8e-10
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 1/107 (0%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSD-GGKPKIKVAYKGEDKTFFPEEV 430
           +NP NTI+DAKR IG+ F    +    K + F V +D  G     V  KG      PEE+
Sbjct: 90  INPKNTIYDAKRFIGKTFTKQELLEIGKLYQFRVTTDKRGNAGFLVGKKGNFTVITPEEI 149

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQKMQVPSLA 571
              V+ K++  AE  L  TV  AV++ P     +K +   ++  SLA
Sbjct: 150 GGYVIKKLRTMAERNLTTTVTKAVMSVP-AEFDIKQRNATVKAASLA 195



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/63 (44%), Positives = 41/63 (65%), Gaps = 2/63 (3%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQ--HGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA 254
           K   +GIDLGTTYSCVG +Q   G+++I +++  ++  PS VAFTD   L+G+ A +Q  
Sbjct: 30  KPKIIGIDLGTTYSCVGAYQAISGRIDIFSDENDDKVVPSLVAFTDKGVLVGEKALSQAE 89

Query: 255 *TP 263
             P
Sbjct: 90  INP 92


>SB_15336| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1068

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 37/87 (42%), Positives = 51/87 (58%), Gaps = 1/87 (1%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 433
           N  NTI   KR IGRKF D  VQ ++ H P++VV        I+V Y G+ + F PE+V 
Sbjct: 118 NLKNTISQFKRFIGRKFSDPAVQKEIPHLPYKVVELPNDSIGIQVQYLGKQEVFSPEQVM 177

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           +M+ T++K TAE  L   V + VI+ P
Sbjct: 178 AMLFTRLKTTAEIALKTKVTDCVISVP 204



 Score = 66.1 bits (154), Expect = 3e-11
 Identities = 34/92 (36%), Positives = 52/92 (56%), Gaps = 3/92 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKG---TGERNVLI 663
           +C   VP+Y+ D QR+   DA   +GLN LR++N+ TA ++AYG+ K+       RNV+ 
Sbjct: 198 DCVISVPSYYTDRQRRCMLDASATAGLNCLRLMNDTTAVSLAYGIYKQDLPTDKPRNVVF 257

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            D+G  +  V I     G  +V STA + + G
Sbjct: 258 VDIGHSSLQVCITAFLKGQLKVLSTAVEPNLG 289



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 22/52 (42%), Positives = 33/52 (63%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ 248
           VG D+G     + V + G +E +AN+  +R TPS+V+  D +RLIG + KNQ
Sbjct: 4   VGFDVGNQSCYIAVARGGGIETVANEFSDRCTPSFVSLGDKQRLIGTSGKNQ 55


>SB_57217| Best HMM Match : Helicase_C (HMM E-Value=0.049)
          Length = 179

 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 42/75 (56%), Positives = 46/75 (61%), Gaps = 26/75 (34%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLN------------------------VLRIINEPTAAAI 615
           VPA+FND+QRQATKDAGTI+GL+                        VLRIINEPTAAAI
Sbjct: 45  VPAHFNDAQRQATKDAGTIAGLDVLSRTASERPPSRFRRRRPHGRSRVLRIINEPTAAAI 104

Query: 616 AYGLDKK--GTGERN 654
           AYGLDK   G  ERN
Sbjct: 105 AYGLDKARGGKAERN 119



 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 22/45 (48%), Positives = 33/45 (73%)
 Frame = +2

Query: 380 IKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           I V   GE ++F PE++S++VL ++K  AEA+LG+ V+ AVIT P
Sbjct: 2   IAVEVCGEKRSFAPEQISAVVLEQLKADAEAFLGQAVKRAVITVP 46


>SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 766

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 22/35 (62%), Positives = 30/35 (85%)
 Frame = +1

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           + ++DLGGGTFD+SIL I+ G+FEVK+T GDT+ G
Sbjct: 2   IAVYDLGGGTFDISILEIQKGVFEVKATNGDTYLG 36


>SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1019

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 4/69 (5%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK----GTGERNVLIFDLG 675
           VP +FN ++R+A   A  + GLNVL+I+N  TA A+ YGL ++     T E++ + +D+G
Sbjct: 112 VPPFFNQAERRALLRAAELVGLNVLQIMNSNTAVALNYGLFQQKSFNDTLEKHFMFYDMG 171

Query: 676 GGTFDVSIL 702
             +   +I+
Sbjct: 172 ASSTVATIV 180



 Score = 32.3 bits (70), Expect = 0.44
 Identities = 15/47 (31%), Positives = 25/47 (53%)
 Frame = +2

Query: 374 PKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           P +K  Y+  D TF PEE+  M+L   +   E +    +++ V+T P
Sbjct: 68  PHVK-NYQQSDVTFTPEELMGMILNHSRFIGEQFADHPIKDVVLTVP 113


>SB_47391| Best HMM Match : HSP70 (HMM E-Value=2.7e-07)
          Length = 592

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 18/28 (64%), Positives = 22/28 (78%)
 Frame = +3

Query: 144 GKVEIIANDQGNRTTPSYVAFTDTERLI 227
           G   IIAND G+R TP+ VAF+DTE+LI
Sbjct: 83  GNTTIIANDAGDRVTPAMVAFSDTEKLI 110


>SB_51671| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 665

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +2

Query: 62  LKIQNGKSTRSRN-RSGYHVLLRWCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCR 238
           L++ N +  ++ + R GY  L R C   R   +  +R  +  H++L      R   +RC 
Sbjct: 225 LRLVNTRDDKTHDKRPGYRKLSRVC-GGRRPNEPYERTARV-HTILSTETETRFCAKRCA 282

Query: 239 QEPGGVNPNNTIFDA 283
               G++P NT F+A
Sbjct: 283 GTASGMDPKNTPFNA 297


>SB_37014| Best HMM Match : HSP70 (HMM E-Value=5.9e-16)
          Length = 212

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 15/25 (60%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +3

Query: 153 EIIANDQGNRTTPSYVAFT-DTERL 224
           ++I N +G+RTTPS VAFT + ERL
Sbjct: 7   KVIENAEGSRTTPSVVAFTPEGERL 31


>SB_27085| Best HMM Match : Filamin (HMM E-Value=1.5)
          Length = 634

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 11/26 (42%), Positives = 20/26 (76%)
 Frame = +1

Query: 655 VLIFDLGGGTFDVSILTIEDGIFEVK 732
           V I+DLG GT++++IL  E G++ ++
Sbjct: 319 VPIYDLGNGTYEMAILFHEPGVYSIR 344


>SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015)
          Length = 600

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = +1

Query: 661 IFDLGGGTFDVSILTIEDGIFEV 729
           +FDLG G+++V  L +E G++ V
Sbjct: 311 VFDLGNGSYEVLFLVMEPGVYRV 333


>SB_55989| Best HMM Match : zf-C2H2 (HMM E-Value=8e-08)
          Length = 1011

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 17/62 (27%), Positives = 28/62 (45%)
 Frame = +2

Query: 371 KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKDKPQK 550
           +PK K   + E+     EE  +M   ++K      LGK V+  + T    ++TL  + Q 
Sbjct: 654 QPKFKKTKEEEEFDKLLEEADAMTQQEVKNVKNIKLGKNVKTQLYTCEPCNITLNSQKQM 713

Query: 551 MQ 556
            Q
Sbjct: 714 SQ 715


>SB_53017| Best HMM Match : Kazal_1 (HMM E-Value=0)
          Length = 1488

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +1

Query: 418  PRGSQFHGAYENEGNCRSLSWQNCAECSYHVPAYFN 525
            PRG Q    Y   G+C S+S +NC + S+ V   +N
Sbjct: 1142 PRGKQI--PYGTAGDCYSVSQENCRKGSFKVTYQYN 1175


>SB_33576| Best HMM Match : Pentaxin (HMM E-Value=1.3e-06)
          Length = 799

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 13/39 (33%), Positives = 21/39 (53%)
 Frame = -2

Query: 752 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRSPVP 636
           +++PA+   S +PS  V +D   VP P   I+  +  VP
Sbjct: 267 YLTPAISTQSTLPSGTVTLDQHNVPHPSGTITLDQHNVP 305


>SB_56695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 339

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = -1

Query: 528 VIEVRGNVITAFCTVLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTS 349
           VI V GNV+     V  +   + + +F+ ++  +     V+S P++ ++ L   PS+ T 
Sbjct: 39  VISVLGNVLVCIACVASKRLHSYTSVFIVSLATSDILVGVVSVPVWISVQLNGEPSMVTM 98

Query: 348 KGQCFMSAC 322
                M  C
Sbjct: 99  PTMYMMWLC 107


>SB_49831| Best HMM Match : 7tm_1 (HMM E-Value=0)
          Length = 339

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = -1

Query: 528 VIEVRGNVITAFCTVLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTS 349
           VI V GNV+     V  +   + + +F+ ++  +     V+S P++ ++ L   PS+ T 
Sbjct: 39  VISVLGNVLVCIACVASKRLHSYTSVFIVSLATSDILVGVVSVPVWISVQLNGEPSMVTM 98

Query: 348 KGQCFMSAC 322
                M  C
Sbjct: 99  PTMYMMWLC 107


>SB_24762| Best HMM Match : Astacin (HMM E-Value=0)
          Length = 733

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 11/29 (37%), Positives = 18/29 (62%)
 Frame = -3

Query: 556 LHLLWLVFESH*STRERDNCILHSFAKIS 470
           ++ LWL F  + S+   D C+LHS A ++
Sbjct: 415 IYTLWLDFSRYYSSASSDICVLHSIAHLA 443


>SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1324

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 7/69 (10%)
 Frame = -1

Query: 738 GGFHLEDTILDGKDGHVEGTAAEVK--DKYISFSSTLFVKTVSNRSSS--RFIDDSENVQ 571
           G F L D+   G++GH EG+ +EV   + ++   +  F +T    S S   F ++S ++Q
Sbjct: 285 GVFVLVDSKDSGENGHTEGSNSEVGTIENFVKTQTKQFKQTACKYSESNLEFNENSAHLQ 344

Query: 570 ---ARDGTC 553
              AR  TC
Sbjct: 345 VYNARISTC 353


>SB_12344| Best HMM Match : ATP-synt_B (HMM E-Value=1.9)
          Length = 341

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 24/101 (23%), Positives = 41/101 (40%)
 Frame = +2

Query: 236 RQEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTF 415
           R+  G V+ + T    + +IG  F     QAD+     +  +     K+++        F
Sbjct: 53  RKSTGKVDNSKTYTAGRYMIGPDFTFKKYQADLHFVQLDTFAVFTSGKLELL-----SVF 107

Query: 416 FPEEVSSMVLTKMKETAEAYLGKTVQNAVITFPRTSMTLKD 538
            P +V S  L+++ ETA       VQ   +    T   +KD
Sbjct: 108 IPNDVKSRYLSQVIETANEERETFVQREKLVRKETEKLIKD 148


>SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 833

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 12/28 (42%), Positives = 15/28 (53%)
 Frame = +2

Query: 668 TSAAVPSTCPSLPSRMVSSR*NPPPATP 751
           T  A P   P++PSR   +R  PPP  P
Sbjct: 784 TKPATPRVPPNIPSRPPGARPTPPPPPP 811


>SB_43628| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 280

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 16/50 (32%), Positives = 27/50 (54%)
 Frame = -1

Query: 528 VIEVRGNVITAFCTVLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLI 379
           VI + GN +T +  +  R    V  +FV ++ L+  G  VLS P+  T++
Sbjct: 36  VIVLFGNSLTLYIVLSNRRLRTVPNLFVVSLALSDLGMGVLSMPMCITVL 85


>SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3235

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +1

Query: 604  AAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTH 753
            A A    L  +G  E  +   D G GT  VS + +E+G +++     D H
Sbjct: 1505 AGAGGLSLAIEGPSEAKLTCQDNGDGTCSVSYIPVEEGDYDIHIKFADEH 1554


>SB_9053| Best HMM Match : TIG (HMM E-Value=0)
          Length = 2990

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +3

Query: 21   HVC*VVLRTSNKTD*KYKMAKAPAVGIDL 107
            HVC +V  T  K   K  ++K PA GI+L
Sbjct: 1200 HVCNIVSNTETKITCKLDVSKTPAPGIEL 1228


>SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1066

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +2

Query: 62  LKIQNGKSTRSRN-RSGYHVLLRWCLPAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCR 238
           L++ N +  ++   R GY  L R C   R   +  +R  +  H++L      R   +RC 
Sbjct: 661 LRLVNTRDDKTHGKRPGYRKLSRVC-GGRRPNEPYERTARV-HTILSTDTETRFCEKRCA 718

Query: 239 QEPGGVNPNNTIFDA 283
               G++P N  F+A
Sbjct: 719 GTASGMDPKNIPFNA 733


>SB_24848| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1506

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 20/68 (29%), Positives = 32/68 (47%)
 Frame = -1

Query: 468  SAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCFMSACTVASSNLRPMR 289
            S   F+F ST  + +S +KV+ SPL  + +    P+     G    S C V   NL    
Sbjct: 1108 SPAKFVFTSTGIVRASTRKVVPSPLRRSKVPPTVPAQRLFNGDRVESICNV--QNLSRCP 1165

Query: 288  RLASNIVL 265
            ++++  VL
Sbjct: 1166 KISNATVL 1173


>SB_3989| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1283

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/41 (34%), Positives = 19/41 (46%)
 Frame = +2

Query: 137  PAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCRQEPGGVN 259
            P R   DH  R       ++    RH A +R   +EPGGV+
Sbjct: 942  PDRHPHDHPDRLTHDRPGLIMGQDRHMADYREPHREPGGVH 982


>SB_7301| Best HMM Match : S-antigen (HMM E-Value=2.1)
          Length = 682

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/41 (34%), Positives = 19/41 (46%)
 Frame = +2

Query: 137 PAREGGDHRQRPGQQDHSVLCCVHRHRASHRRCRQEPGGVN 259
           P R   DH  R       ++    RH A +R   +EPGGV+
Sbjct: 75  PDRHPHDHPDRLTHDRPGLIMGQDRHMADYREPHREPGGVH 115


>SB_50059| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 15/42 (35%), Positives = 18/42 (42%)
 Frame = +1

Query: 202 RSQTPSVSSEMPPRTRWREPQQHNIRCQTSHRT*VRRCYCAS 327
           R+  P   S+ PP  RW+ P Q     QT H     R Y  S
Sbjct: 37  RTAEPLSHSKRPPPRRWKAPLQRCRMSQTQHGYRQGRAYTFS 78


>SB_42630| Best HMM Match : Ets (HMM E-Value=0)
          Length = 631

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +1

Query: 103 IWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 246
           IW P+   L++S     R+S +     PLR  L    P VSS +P  T
Sbjct: 42  IWPPKKQHLMASYPSTSRASASRSHLFPLRTGLPPVPPLVSSPLPSPT 89


>SB_45916| Best HMM Match : Cadherin (HMM E-Value=0)
          Length = 1774

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = -1

Query: 663 DKYISFSSTLFVKTVSNRSSSRFIDDSEN 577
           +K ISF  +LF+  VSN S+ R+I  +E+
Sbjct: 752 NKVISFGPSLFMDKVSNASAGRYICIAES 780


>SB_34715| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 977

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = +1

Query: 103 IWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 246
           IW P+   L++S     R+S +     PLR  L    P VSS +P  T
Sbjct: 388 IWPPKKQHLMASYPSTSRASASRSHLFPLRTGLPPVPPLVSSPLPSPT 435


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,454,835
Number of Sequences: 59808
Number of extensions: 614002
Number of successful extensions: 2110
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 1820
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2097
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2070332524
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -