SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20053
         (739 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_40390| Best HMM Match : BON (HMM E-Value=0.68)                      30   2.3  
SB_9208| Best HMM Match : p450 (HMM E-Value=0)                         29   5.2  
SB_47423| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.9  
SB_27204| Best HMM Match : RVT_1 (HMM E-Value=0.00085)                 28   9.1  
SB_48764| Best HMM Match : RhoGAP (HMM E-Value=0)                      28   9.1  

>SB_40390| Best HMM Match : BON (HMM E-Value=0.68)
          Length = 561

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 14/38 (36%), Positives = 22/38 (57%)
 Frame = +2

Query: 104 KKTNILVSIEDVSFPSKILKKTSFSHSVDVLSCVKQSV 217
           KK N+LV  E V+     ++ TS  H+V++L   K+ V
Sbjct: 264 KKINLLVQKEAVTINGYSVRATSIDHAVELLQIAKKKV 301


>SB_9208| Best HMM Match : p450 (HMM E-Value=0)
          Length = 544

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = -1

Query: 205 YTRQYVNGMRKGRFFKYFRWKRYVFN 128
           YT Q+V G R      YF W R++ N
Sbjct: 253 YTEQFVQGFRAASLVDYFPWLRHLPN 278


>SB_47423| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 855

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = -3

Query: 413 FSISQFTSHQARIFFLT**SRDSLIFFSYTLKFYTKILILYSFDEFSMAAFDFA-RTRKT 237
           FS   F   Q +++F      D+L + SY+ K +T I+    FDE+ +    FA R  K 
Sbjct: 386 FSFLDFKGGQEKLYFCGGPDSDTLAY-SYSRKNFTGIIQQLRFDEYQVIDEVFADRVHKE 444

Query: 236 YTSM 225
           + ++
Sbjct: 445 FVAV 448


>SB_27204| Best HMM Match : RVT_1 (HMM E-Value=0.00085)
          Length = 646

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 20/64 (31%), Positives = 31/64 (48%)
 Frame = +2

Query: 44  WTKLYEDIRVKSVTCRKLKKKKTNILVSIEDVSFPSKILKKTSFSHSVDVLSCVKQSVVY 223
           ++K ++ +  K + CRKLK    N  V    VSF   +L    FS  V+ +  V  S + 
Sbjct: 490 FSKAFDSVSHK-ILCRKLKSYDINPYVINWIVSFLGTVLGPVLFSIMVNDIIPVNPSKIL 548

Query: 224 PLKY 235
            +KY
Sbjct: 549 LVKY 552


>SB_48764| Best HMM Match : RhoGAP (HMM E-Value=0)
          Length = 583

 Score = 27.9 bits (59), Expect = 9.1
 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%)
 Frame = +1

Query: 421 CLYEEEK--KGGYGNFTFIRDLINS 489
           C  E E   KG YGNFTF  DL  S
Sbjct: 525 CAVEREVTGKGSYGNFTFTMDLFYS 549


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,155,622
Number of Sequences: 59808
Number of extensions: 321021
Number of successful extensions: 581
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 553
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 580
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1986074805
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -