SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20052
         (684 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_104| Best HMM Match : No HMM Matches (HMM E-Value=.)                28   6.1  
SB_5218| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.1  

>SB_104| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 320

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 10/25 (40%), Positives = 17/25 (68%)
 Frame = +1

Query: 43  IN*FVVNCDPEKTINCFKMDDPELD 117
           +N + ++ +PEKTI C+K+    LD
Sbjct: 94  LNYYFISVEPEKTIICYKLRSESLD 118


>SB_5218| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 325

 Score = 27.9 bits (59), Expect = 8.1
 Identities = 16/69 (23%), Positives = 26/69 (37%)
 Frame = +3

Query: 183 CQSTTRKNASNGTS*THYIESSAKQDARARLNTIKLGRPEKAAMIENMICRMAQMGQIQC 362
           C +T        T+  +  + +  Q   A+ NTI+       A    + C   Q   IQC
Sbjct: 144 CNTTQCNTIQGNTAQCNTAQCNTTQCNTAQCNTIQGNTARNTAQCNTIQCNTLQCNTIQC 203

Query: 363 KITEPDLIQ 389
             T+ +  Q
Sbjct: 204 NTTQCNTTQ 212


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,446,854
Number of Sequences: 59808
Number of extensions: 307796
Number of successful extensions: 571
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 542
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 570
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1769412099
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -