SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20051
         (781 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)                   127   9e-30
SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   2e-07
SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)               43   3e-04
SB_40813| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.016
SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)                     33   0.26 
SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.34 
SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)                33   0.34 
SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)               31   0.79 
SB_35448| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-10)              31   1.4  
SB_29777| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.2  
SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_23513| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_54127| Best HMM Match : Keratin_B2 (HMM E-Value=2.8)                29   5.6  
SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.6  
SB_36714| Best HMM Match : RBM1CTR (HMM E-Value=0.72)                  29   5.6  
SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.6  
SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.6  
SB_11602| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.6  
SB_43658| Best HMM Match : Pkinase (HMM E-Value=1.49939e-42)           28   7.4  
SB_38321| Best HMM Match : ZZ (HMM E-Value=8.1e-09)                    28   9.8  
SB_25617| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.8  
SB_24314| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.8  

>SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 833

 Score =  127 bits (307), Expect = 9e-30
 Identities = 60/107 (56%), Positives = 73/107 (68%), Gaps = 1/107 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           CV  VC    +      AERIKP+LFMNKMDR            YQTF RIVE++NVIIA
Sbjct: 132 CVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLDQEDLYQTFARIVESINVIIA 191

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
           TY+D+ GPMG ++V P KG+V FGSGLHGWAFTLKQ SE+Y+   ++
Sbjct: 192 TYSDEDGPMGNIQVGPEKGTVAFGSGLHGWAFTLKQISEIYSAKFKI 238



 Score =  124 bits (300), Expect = 6e-29
 Identities = 59/65 (90%), Positives = 62/65 (95%)
 Frame = +1

Query: 61  VNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRK 240
           VNFT D+IRG+MDKK NIRNMSVIAHVDHGKSTLTDSLVSKAGIIA A+AGETRFTDTRK
Sbjct: 1   VNFTTDQIRGIMDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAAAKAGETRFTDTRK 60

Query: 241 DEQDR 255
           DEQDR
Sbjct: 61  DEQDR 65



 Score =  112 bits (270), Expect = 3e-25
 Identities = 57/85 (67%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 CITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVT 434
           CITIKSTAIS+++EL E D  +IT P  ++  E+GFLINLIDSPGHVDFSSEVTAALRVT
Sbjct: 66  CITIKSTAISLYYELPESDFEYITQP--KDPKERGFLINLIDSPGHVDFSSEVTAALRVT 123

Query: 435 DGALXXXXXXXXXXXQTETVLRQAM 509
           DGAL           QTETVLRQA+
Sbjct: 124 DGALVVVDCVSGVCVQTETVLRQAI 148


>SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 227

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 21/32 (65%), Positives = 26/32 (81%)
 Frame = +2

Query: 683 PSKGSVGFGSGLHGWAFTLKQFSEMYATNSRL 778
           P KG+V FGSGLHGWAFTLKQ SE+Y+   ++
Sbjct: 34  PEKGTVAFGSGLHGWAFTLKQISEIYSAKFKI 65


>SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2670

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +1

Query: 112  IRNMSVIAHVDHGKSTLTDSLVSKAGIIA 198
            +RN S++AHVDHGKSTL D L+   G I+
Sbjct: 1941 VRNFSIVAHVDHGKSTLADRLLEVTGTIS 1969


>SB_40813| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 809

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 18/83 (21%), Positives = 41/83 (49%)
 Frame = +2

Query: 512 ERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSK 691
           E +   + +NK+DR            Y   + +++ VN +++ +++      ++ + P  
Sbjct: 180 ENLAITICINKIDRLILELKLPPTDAYYKLKHVIDEVNGLLSVFSEGA---DDLVISPLL 236

Query: 692 GSVGFGSGLHGWAFTLKQFSEMY 760
           G+V F S  + + FTL  F+++Y
Sbjct: 237 GNVCFASSSYHFCFTLLSFAKLY 259



 Score = 35.1 bits (77), Expect = 0.064
 Identities = 20/85 (23%), Positives = 40/85 (47%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           + N+ ++ +  +MD    IRN+++  H+  GK+   D L  +      A+ G+    +T 
Sbjct: 112 LTNYNIEYLADLMDNPELIRNVALAGHLHSGKTAFLDCLFEQTHPELEAKEGKEVMLNTE 171

Query: 238 KDEQDRASPLNLRPSLCSSSLKRKI 312
           +     A   NL  ++C + + R I
Sbjct: 172 R-LLKHAVQENLAITICINKIDRLI 195


>SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 359

 Score = 33.1 bits (72), Expect = 0.26
 Identities = 20/78 (25%), Positives = 34/78 (43%)
 Frame = +3

Query: 264 IKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGA 443
           IK  A S F E+E +  + +        + +   IN++D+PGH DF+ +    L   D  
Sbjct: 48  IKKGATSDFMEIERQRGISVAT-SVLAFNYRDKKINILDTPGHKDFAEDTFRTLTAVDSV 106

Query: 444 LXXXXXXXXXXXQTETVL 497
           +           QTE ++
Sbjct: 107 IVVIDVAKGVEEQTEKLV 124



 Score = 30.7 bits (66), Expect = 1.4
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +1

Query: 97  DKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARA 210
           D+ +  R   +I+H D GK+TLT+ L+   G I  A A
Sbjct: 5   DEIKRRRTFGIISHPDAGKTTLTEKLLLFGGAIQEAGA 42


>SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 545

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           ++++ HVDHGK+TL D+L   + + AG   G T+
Sbjct: 31  VTIMGHVDHGKTTLLDAL-RNSSVAAGEAGGITQ 63



 Score = 29.5 bits (63), Expect = 3.2
 Identities = 18/55 (32%), Positives = 22/55 (40%)
 Frame = +3

Query: 345 KSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           K   G  I  ID+PGH  F+S       VTD  +           QT   +R AM
Sbjct: 71  KLPSGEKITFIDTPGHAAFNSMRARGANVTDIVVLVVAADDGVKTQTVESIRHAM 125


>SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)
          Length = 106

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCG 32


>SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)
          Length = 240

 Score = 31.5 bits (68), Expect = 0.79
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           ++V+ HVDHGK++L D  +  A +I G   G T+
Sbjct: 94  VTVMGHVDHGKTSLLD-YIRNANVIEGESGGITQ 126


>SB_35448| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-10)
          Length = 563

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIAT 640
           + E I+P L +NK+DR            +   Q+I+E VN I  T
Sbjct: 126 WLENIRPCLVLNKIDRLITELKYSPSEAFIHLQQILEQVNAITGT 170


>SB_29777| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 217

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = -3

Query: 515 ARHSLTQYCFSLYTHTRHTVNNHKGSISDT 426
           ARHS TQY  + ++ T+H+   H  +  DT
Sbjct: 81  ARHSTTQYSTTQHSTTQHSTTQHSTTQHDT 110


>SB_42973| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1864

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 3/66 (4%)
 Frame = -1

Query: 478 THTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKL---IKKPFSLFSRWSGFVMNTKS 308
           TH+P +  TTT AP+         E    C G+ ++L     K  +L  R+ G       
Sbjct: 612 THSPSSTPTTTGAPTTAGFNEFNLEASEDCTGDYVELRDGDSKSAALIGRYCGTNAPMML 671

Query: 307 FSSSSK 290
             SS K
Sbjct: 672 MGSSDK 677


>SB_23513| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 340

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +1

Query: 151 KSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNL-RPSLCSSSLKR 306
           K+ + D+LV   GI+   R G   +TD    + +RA+     R SL +++LKR
Sbjct: 182 KTLIKDNLVGPKGIVVDPRTGLMFWTDKETPKIERATLAGRDRISLVTTALKR 234


>SB_54127| Best HMM Match : Keratin_B2 (HMM E-Value=2.8)
          Length = 289

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 22/73 (30%), Positives = 32/73 (43%)
 Frame = -1

Query: 514 LGIA*RSTVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRW 335
           LGI      S C  + DT  + T +        + +E ++T P E I L+  P     R 
Sbjct: 93  LGIPVSPNDSTCRQSTDTSISITTSSQAQDDITIVAEVQATQP-EVIDLVSTP--TIRRG 149

Query: 334 SGFVMNTKSFSSS 296
           S FV++  S  SS
Sbjct: 150 SSFVVDLTSEPSS 162


>SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1805

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 18/93 (19%), Positives = 39/93 (41%), Gaps = 1/93 (1%)
 Frame = +1

Query: 37  KNHK-PSKMVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAG 213
           K H+ P  +   T    R M+  + N +++        GK+  T  ++     +AG   G
Sbjct: 139 KRHEVPPHIYAITDTAYRSMLQDREN-QSILCTGESGAGKTENTKKVIQYLAAVAGHSYG 197

Query: 214 ETRFTDTRKDEQDRASPLNLRPSLCSSSLKRKI 312
           +   T  + ++  ++ P ++  + C   L R +
Sbjct: 198 KVHATPQKTEKGGKSKPTSMTQTKCVGDLLRHV 230


>SB_36714| Best HMM Match : RBM1CTR (HMM E-Value=0.72)
          Length = 300

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = -1

Query: 439 PSVTRSAAVTSEEKSTCPGESIKLIKKPFSLFSRWSGFVMN 317
           P   R A        TCPGE ++L+ +     +RWS  V+N
Sbjct: 242 PPPERQALACLRHTHTCPGEQLRLVGQ-LGHRARWSSSVIN 281


>SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1393

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = -2

Query: 717 RPDPKPTEPLLGSTRTSPMGPPSS 646
           +P PK T P+ G+ +  PMGPP S
Sbjct: 641 KPRPKSTPPM-GAVQVLPMGPPPS 663


>SB_18656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3292

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 15/47 (31%), Positives = 22/47 (46%)
 Frame = -1

Query: 496  STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKSTCPGESIKLIKKP 356
            ST+     T +  STTT A      ++ TS  +     E+ + IKKP
Sbjct: 2817 STIGTSRPTSEAFSTTTAATGTIPDSSATSATEGLSDAETEEFIKKP 2863


>SB_11602| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 440

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -1

Query: 478 THTPDTQSTTTRAPSVTRSAAVTSEEKST 392
           T TP+TQSTTT  P  T+S   T E +ST
Sbjct: 346 TETPETQSTTT-TPE-TQSTTTTPETQST 372


>SB_43658| Best HMM Match : Pkinase (HMM E-Value=1.49939e-42)
          Length = 457

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +1

Query: 427 VSLMEPLWLLTVCLVCVYKLKQYCVRLCRAHQAYSVHEQNGPCS 558
           +S+  P+  L VCL+ VY + ++ ++    HQ+   H+  GP S
Sbjct: 114 ISICAPVAALIVCLIIVYMIFRHLMKHHAHHQSVPRHDL-GPVS 156


>SB_38321| Best HMM Match : ZZ (HMM E-Value=8.1e-09)
          Length = 584

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -1

Query: 760 IHLRELFEGESPPMKTRPETNRALARVDTH-LTHGTTIIVICGYNDVNI 617
           + LRE+ EG  PP K     + +L+  D+   T G+T++     +D ++
Sbjct: 307 VELREVLEGMVPPEKVESALSASLSLTDSEPSTGGSTVLAEIKVSDASM 355


>SB_25617| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 479

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = -2

Query: 681 STRTSPMGPPSSLYVAIMTLTFSTIRWNV 595
           +T T P  PP+SLY   +  +  T+ W+V
Sbjct: 262 NTCTGPPSPPTSLYKPFLNSSAITLSWSV 290


>SB_24314| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 453

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 9/32 (28%), Positives = 22/32 (68%), Gaps = 1/32 (3%)
 Frame = -3

Query: 485 SLYTHTRHTVNNHKGSIS-DTECSCYFRREIN 393
           S Y+ + HT+N+H+ + + +T C+C ++  ++
Sbjct: 192 SPYSLSHHTINSHRKAYNEETSCTCRYKEGVS 223


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,781,746
Number of Sequences: 59808
Number of extensions: 553383
Number of successful extensions: 1895
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 1620
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1886
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2131907602
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -