SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20050
         (647 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09)             105   4e-23
SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)                98   6e-21
SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)           97   8e-21
SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0)                 89   4e-18
SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)                     36   0.028
SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.26 
SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)               32   0.35 
SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)                    32   0.35 
SB_24425| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)              30   1.9  
SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26)              30   1.9  
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.5  
SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.3  
SB_30255| Best HMM Match : Keratin_B2 (HMM E-Value=3.8)                28   5.7  
SB_22769| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-07)              28   5.7  
SB_19621| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.7  
SB_32114| Best HMM Match : PAN (HMM E-Value=0.11)                      28   7.5  
SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.5  
SB_1541| Best HMM Match : MMR_HSR1 (HMM E-Value=0.12)                  28   7.5  

>SB_50386| Best HMM Match : GTP_EFTU (HMM E-Value=1.6e-09)
          Length = 123

 Score =  105 bits (251), Expect = 4e-23
 Identities = 48/82 (58%), Positives = 61/82 (74%)
 Frame = +1

Query: 271 IDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 450
           +D+ L +F+T    +T++DAPGH+DFI NMITG +QAD A+L+V A TGEFEAG    GQ
Sbjct: 1   MDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQ 60

Query: 451 TREHALLAFTLGVKQLIVGETK 516
           TREHA+L  +LGV QLIV   K
Sbjct: 61  TREHAILVRSLGVTQLIVAINK 82


>SB_18076| Best HMM Match : GTP_EFTU (HMM E-Value=0.018)
          Length = 106

 Score = 97.9 bits (233), Expect = 6e-21
 Identities = 53/81 (65%), Positives = 57/81 (70%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           M KEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE+ E+   S      +
Sbjct: 1   MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEVLCFS-SCLLFM 59

Query: 236 DKLKAELSVVSQSILLSGSSK 298
            KLK EL    +   L   SK
Sbjct: 60  SKLKFELPCTHKIYFLFKLSK 80


>SB_8918| Best HMM Match : GTP_EFTU (HMM E-Value=1.09301e-43)
          Length = 547

 Score = 97.5 bits (232), Expect = 8e-21
 Identities = 40/83 (48%), Positives = 60/83 (72%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ++G T+++    F+T   + T++DAPGH+ F+ NMI+G +QAD  VL+++A  GEFE G 
Sbjct: 205 DKGNTVEVGRAAFDTDTKHFTLLDAPGHKSFVPNMISGATQADLGVLVISARKGEFETGF 264

Query: 436 SKNGQTREHALLAFTLGVKQLIV 504
            + GQTREHA+LA T GVK L++
Sbjct: 265 ERGGQTREHAMLAKTAGVKHLVI 287



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/38 (42%), Positives = 26/38 (68%)
 Frame = +2

Query: 140 YKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 253
           Y  G +DKRT+EK+E+EA+E  + ++  +W LD  + E
Sbjct: 166 YLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEE 203



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 11/24 (45%), Positives = 21/24 (87%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNP 607
           ++E R+EEIK +++ ++KK+G+NP
Sbjct: 299 WNEERYEEIKVKLTPFLKKVGFNP 322


>SB_51711| Best HMM Match : GTP_EFTU_D3 (HMM E-Value=0)
          Length = 322

 Score = 88.6 bits (210), Expect = 4e-18
 Identities = 40/49 (81%), Positives = 43/49 (87%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQ 378
           + + K   ERGITIDIALWKFET KYYVT+IDAPGHRDFIKNMITGTSQ
Sbjct: 12  LDKLKAERERGITIDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQ 60



 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 18/18 (100%), Positives = 18/18 (100%)
 Frame = +2

Query: 200 MGKGSFKYAWVLDKLKAE 253
           MGKGSFKYAWVLDKLKAE
Sbjct: 1   MGKGSFKYAWVLDKLKAE 18


>SB_7329| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 359

 Score = 35.9 bits (79), Expect = 0.028
 Identities = 13/54 (24%), Positives = 28/54 (51%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +RGI++  ++  F      + I+D PGH+DF ++     +  D  ++++    G
Sbjct: 62  QRGISVATSVLAFNYRDKKINILDTPGHKDFAEDTFRTLTAVDSVIVVIDVAKG 115


>SB_50050| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 545

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 15/35 (42%), Positives = 18/35 (51%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +T ID PGH  F      G +  D  VL+VAA  G
Sbjct: 78  ITFIDTPGHAAFNSMRARGANVTDIVVLVVAADDG 112


>SB_3698| Best HMM Match : GTP_EFTU (HMM E-Value=9.3e-34)
          Length = 240

 Score = 32.3 bits (70), Expect = 0.35
 Identities = 14/49 (28%), Positives = 21/49 (42%)
 Frame = +1

Query: 262 GITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 408
           GIT  I  +  +     +  +D PGH  F      G    D  +++VAA
Sbjct: 123 GITQHIGAYSVKVGDQKIAFLDTPGHEAFTAMRARGAQVTDLVIIVVAA 171


>SB_44740| Best HMM Match : GTP_EFTU (HMM E-Value=0)
          Length = 833

 Score = 32.3 bits (70), Expect = 0.35
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           M K+    N+ VI HVD GKST T  L+ K G
Sbjct: 12  MDKKLNIRNMSVIAHVDHGKSTLTDSLVSKAG 43



 Score = 28.3 bits (60), Expect = 5.7
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +1

Query: 307 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 99  FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 135


>SB_24425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 947

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 21/65 (32%), Positives = 29/65 (44%)
 Frame = -3

Query: 525 VEPFCFSYDELFDTEGESEQGMLTGLTVLRDTSFEFTGTGSYDEHSAISLRGSCDHVLDE 346
           VEPF F  D       ES   +  G  + RD   +   T SY+EHSA       D +L  
Sbjct: 600 VEPFVFDNDHFAIGRRESLDSL--GTPISRDCDDD---TASYEEHSAHPFERELDEMLAS 654

Query: 345 ISVSR 331
           ++ S+
Sbjct: 655 VTSSQ 659


>SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10)
          Length = 783

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           IID PGH  F      G+S  D A+L+V
Sbjct: 682 IIDTPGHESFSNLRSRGSSLCDMAILVV 709


>SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 4072

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 2/81 (2%)
 Frame = -3

Query: 486  TEGESEQGMLTGLTVLRDTSFEFTGTGSYDEHSAISLRGSCDH--VLDEISVSRSINDGN 313
            T G SE  +  G TVL +++    GT    E +A  L        V  E S+S   ++  
Sbjct: 1469 TTGASESTVAPGTTVLPESTVT-PGTTVSSESTATPLTNLASESTVTLETSISSEASEST 1527

Query: 312  IVLASFELPESNIDCDTTLSS 250
            +   +   PES +  +TT++S
Sbjct: 1528 VASGTTLAPESTVAPETTVAS 1548


>SB_43410| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-26)
          Length = 541

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 16/65 (24%), Positives = 29/65 (44%)
 Frame = +1

Query: 322 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           +D PGH   +  M+ G +  D A+L++A              QT EH      + +K ++
Sbjct: 69  VDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSEHLAAIEIMKLKHIL 122

Query: 502 VGETK 516
           + + K
Sbjct: 123 ILQNK 127


>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 13/24 (54%), Positives = 17/24 (70%)
 Frame = +2

Query: 71  THINIVVIGHVDSGKSTTTGHLIY 142
           T I + V+G+V+SGKST  G L Y
Sbjct: 111 TDIRMAVLGNVESGKSTLLGVLTY 134


>SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2670

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +2

Query: 80   NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 178
            N  ++ HVD GKST    L+   G I K +  K
Sbjct: 1943 NFSIVAHVDHGKSTLADRLLEVTGTISKSSDNK 1975


>SB_30255| Best HMM Match : Keratin_B2 (HMM E-Value=3.8)
          Length = 304

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%)
 Frame = -1

Query: 557 PQIWAHCMVVQWNHFVSPTMSC-LTPRVKASKAC 459
           P  W H MVV W H  SP  +  L+P  K  + C
Sbjct: 183 PVTWCHRMVVTWKHDGSPRRTVDLSPLNKYCQHC 216


>SB_22769| Best HMM Match : GTP_EFTU (HMM E-Value=3.9e-07)
          Length = 203

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 13/80 (16%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSK-------------YYVTIIDAPGHRDFIKNMITGTSQADCAVL 396
           ERGIT+D+    F+ +                +T++D PGH   IK +I G      A +
Sbjct: 72  ERGITLDLGFSSFQVALPEHLRSAGSEHDLLQMTLVDCPGHASLIKTIIGG------AQI 125

Query: 397 IVAAGTGEFEAGISKNGQTR 456
           I   GT   E G  ++G+ +
Sbjct: 126 IGECGT--IEGGFGQSGKVK 143


>SB_19621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 730

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 2/79 (2%)
 Frame = +2

Query: 128 GHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAELSVVSQSILLSGSSKLAS 307
           GH      G    T    E + ++M K  F Y ++LDK   EL   SQ I     + + S
Sbjct: 389 GHSTTSKDGALAETKIATEDKVKKMEKVLFDYRFLLDKSNFELQQHSQHIEAVRKNAVES 448

Query: 308 TMLPSLMLLD--TEISSRT 358
                + L D  TE+ S+T
Sbjct: 449 ITSAIIKLKDFQTEVESKT 467


>SB_32114| Best HMM Match : PAN (HMM E-Value=0.11)
          Length = 390

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +3

Query: 480 PRCQTAHRRRNKMVPLNHHTVSPDLRKSRRKYPH 581
           P C TA  +R K+  +    +S ++RK + +YPH
Sbjct: 340 PGCYTARTKRKKIADI----LSNEIRKVKERYPH 369


>SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 766

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 20/77 (25%), Positives = 37/77 (48%)
 Frame = +2

Query: 83  IVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAELSV 262
           IV +   D G       +I   GG+ K  IE   KEA++  +   +    ++KLK E++ 
Sbjct: 291 IVNVSARDKGTGREQQIVIQSSGGLSKDAIENMIKEAEKYAEADKQKK--VEKLKEEIAK 348

Query: 263 VSQSILLSGSSKLASTM 313
           V + +L +  ++   T+
Sbjct: 349 V-REVLANKDNETGETI 364


>SB_1541| Best HMM Match : MMR_HSR1 (HMM E-Value=0.12)
          Length = 347

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = +2

Query: 5   TSYLGYYTQFVIRD*PKMGKEK-THINIVVIGHVDSGKSTTTGHLIY 142
           T+ LG   ++++R   +M +     + + V+G+VD+GKST  G L +
Sbjct: 207 TAELGTVGEYLVR--VRMDENDFMEVRVAVVGNVDAGKSTLLGVLTH 251


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,238,341
Number of Sequences: 59808
Number of extensions: 413192
Number of successful extensions: 1265
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 1159
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1263
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1645141000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -