SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20049
         (646 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.7  
SB_5835| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   5.7  
SB_30534| Best HMM Match : EGF (HMM E-Value=0.12)                      28   7.5  
SB_16082| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.5  
SB_8817| Best HMM Match : I-set (HMM E-Value=0)                        28   7.5  
SB_57867| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.9  

>SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 931

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 19/57 (33%), Positives = 25/57 (43%)
 Frame = -3

Query: 644 PITPQGVCHPKLPPRRTPPCFCHERASVLAERRVPVSGRREPS**QHGEGRLVPGQP 474
           P  P G+  P +PP   PP F  ++A +  E  +   GR        G GR  PG P
Sbjct: 278 PGAPPGMLPPGMPPHGMPPGFGPDQAHMQFE-AMGFPGRGGGG--MRGRGRGFPGMP 331


>SB_5835| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 875

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 10/23 (43%), Positives = 18/23 (78%)
 Frame = +1

Query: 403 SLDHAAGL*KIPPWSCKSRIRRR 471
           SL+ AAG  ++PP +C +R+R++
Sbjct: 18  SLESAAGSKRLPPRACSNRVRKK 40


>SB_30534| Best HMM Match : EGF (HMM E-Value=0.12)
          Length = 521

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%)
 Frame = +1

Query: 436 PPWSCKSRIRRRRG*PGTSLPSPCCHQEGSR--RPDTGTLR 552
           PP + + R + RR  P T LP P  ++  +R  RPD  T R
Sbjct: 277 PPTTQRPRPKTRRPEPRTELPQPRTYRPETRTYRPDPRTYR 317


>SB_16082| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 18/61 (29%), Positives = 26/61 (42%)
 Frame = -1

Query: 478 SLCDAGSWICMTMAEFFIILPHGPNCCIGDGAFRDLVLLLSKYSS*ALTSSVLPDSWEYC 299
           SLC    +    + EFF+      NC   D    DL +    Y + AL  ++   +WE C
Sbjct: 6   SLCVFVVFFVKPLIEFFVFKTK-KNCAPCDYRTHDLQISRFDYQTDALPIALTTPTWEMC 64

Query: 298 L 296
           L
Sbjct: 65  L 65


>SB_8817| Best HMM Match : I-set (HMM E-Value=0)
          Length = 2526

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 13/47 (27%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = +3

Query: 396  IQQFGPCGRIMKNSAMVMQIQDPASQ--RLTWYKPPLTVLSSRRFTT 530
            IQ++     +++ S++ ++ Q   ++  R+TWYK  + +  S RF T
Sbjct: 873  IQEYSKEIEVVEGSSVTIECQSSGAEDARITWYKDDVPLGDSPRFET 919


>SB_57867| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 890

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = +3

Query: 237 FW*LRVIRVAVMALFKKMLRRQYSHESGKTELVRAQE--EYLDRRRTRSLNAPSPIQQFG 410
           ++ LR++R        + L+   S E  +++++ ++E  EY+D R T  ++ P P Q  G
Sbjct: 361 YYDLRLLRFCAFFTHLESLQEPPSPELYESDIMLSEEDKEYVDLRDTGDVDGPLPEQTLG 420


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,005,563
Number of Sequences: 59808
Number of extensions: 472084
Number of successful extensions: 1165
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1058
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1159
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1633044375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -